KEGG   Vigna unguiculata (cowpea): 114179296Help
Entry
114179296         CDS       T06017                                 

Definition
(RefSeq) calcium/calmodulin-regulated receptor-like kinase 1
Organism
vun  Vigna unguiculata (cowpea)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase ABC1 FAM176
Motif
Other DBs
NCBI-GeneID: 114179296
NCBI-ProteinID: XP_027921384
Position
3
AA seq 424 aa AA seqDB search
MTRPTLIFIIGICIGFVVGIGLTLSIVHCLVRRRKPTEVDKSISHKAVTIPVNVKGYGSN
STLSEGEESPRTSEWSNMPLWLENLRRSSAVSACGIPKYSYKDIQRATSNFTTIIGNGAF
GPVYKAQMATGETVAVKVLGTNSRQGEQEFLTEVLLLGRLHHRNLVDLVGYVADKGKHML
LYTYMSNGSLASHLYDFGKNREPLNWDLRLGIALDVARGLEYLHCGASPPVVHRDIKSCN
ILLDQSMKAKVTDFGLSRPEMIIPRTSNIRGTFGYLDPEYLSTKTFTKKSDVYSFGVLLF
ELITGRNPQLGLMEYVKLAAMEGEGKVGWEEIVDGQLNGKYDLHNLNDMASLAFICVNEV
SQSRPPMCEIVQALSELCKRNSKNLGRTSSAAALKDVCIEVDQIETKDFTSTASTNILGR
LHSR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaccagacctaccttgattttcataataggaatttgtataggctttgtggttgggatt
ggtttgacattatccatagtacactgcctcgtaaggagaaggaagcccacagaggttgat
aagagcatttctcacaaagcagtgacaattcctgttaatgtcaaagggtatggttctaac
tcaacattatcagagggcgaggagtcacccagaacatctgagtggagtaacatgccttta
tggttggaaaatcttaggagaagcagtgcagtgtcagcttgtggaattcccaagtattct
tacaaagatatacaaagggctacttctaatttcaccaccatcattggcaacggagccttt
ggtcctgtttataaagcgcagatggctacgggtgagacagttgcagttaaagtcttaggt
actaattcaagacaaggagagcaggaatttttaactgaggttttattacttggaagatta
catcacagaaaccttgtggatttggtgggatatgtggctgacaaaggaaaacatatgctt
ctttacacttacatgagcaatggcagccttgcttcccatttgtatgatttcggaaaaaat
cgtgagccactgaattgggatttgaggcttggtatagcactagatgttgcaaggggactg
gaatatctacattgtggggcttctccacctgttgtgcaccgtgacatcaaatcttgcaac
atactgttggatcagtctatgaaggccaaggtcactgactttgggctttccagacctgag
atgatcatacctcgcacatcaaatatccgtggaacattcggatatcttgatcctgagtat
ttgtctacaaaaaccttcactaagaaaagtgatgtttatagctttggtgtgctactattt
gagctcatcactggcaggaatccgcagcttgggctcatggaatatgtaaaactagcagcc
atggaaggtgaaggtaaggttggatgggaagaaattgtggacgggcaattaaatggaaaa
tatgatttgcataatcttaacgacatggcttcacttgcattcatatgtgttaatgaagtc
tcccaaagccgaccaccgatgtgtgaaattgttcaagcattatcagagctatgtaagagg
aatagtaaaaatcttggccgaacatcatctgctgctgcattaaaggatgtgtgtattgaa
gtggaccagattgaaactaaggactttacatcaactgcgagtacaaatatattgggcaga
ttgcatagccgatga

DBGET integrated database retrieval system