KEGG   Vigna unguiculata (cowpea): 114180221Help
Entry
114180221         CDS       T06017                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain 1, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
vun  Vigna unguiculata (cowpea)
Pathway
vun00630  Glyoxylate and dicarboxylate metabolism
vun00710  Carbon fixation in photosynthetic organisms
vun01100  Metabolic pathways
vun01110  Biosynthesis of secondary metabolites
vun01200  Carbon metabolism
Module
vun_M00165  Reductive pentose phosphate cycle (Calvin cycle)
vun_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
vun_M00532  Photorespiration
vun_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:vun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    114180221
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    114180221
Enzymes [BR:vun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     114180221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 114180221
NCBI-ProteinID: XP_027922314
Position
4
AA seq 180 aa AA seqDB search
MASSMISSPAVTTVNRAGAGAGMVAPFTGLKSLGGFPTRKTNNDITSVANNGGRVQCMQV
WPTTGKKKFETLSYLPDLTEEQLLKEIDYLLRNGWIPCLEFTLQDPFPYREQNRSPGYYD
GRYWTMWKLPMFGCTDATQVLQEVVEARTAHPNGFVRIIGFDNVRQVQCISFIAYKAPGF
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcaatgatctcctccccagctgttacgaccgttaaccgtgctggtgccggt
gccggcatggtggctccgttcactggcctgaagtccttgggtgggttcccaacgaggaag
acgaacaatgacattacttcggttgcaaacaacggtggaagagtgcaatgcatgcaggtg
tggccaaccactgggaagaagaagttcgagactctgtcgtaccttccagacctgactgaa
gaacaactgcttaaggagatagattaccttcttaggaatggatggatcccttgcttggaa
tttacattgcaggacccattcccataccgtgagcaaaacaggtcacctggatactatgat
ggaaggtactggaccatgtggaagctgcctatgtttgggtgcactgatgctactcaggtg
ttgcaggaggttgtagaggccaggactgctcaccccaacggcttcgtccgtatcattgga
ttcgacaacgttcgtcaagtccagtgcatcagtttcattgcctacaaggcccctggcttc
taa

DBGET integrated database retrieval system