KEGG   Vigna unguiculata (cowpea): 114181695Help
Entry
114181695         CDS       T06017                                 

Definition
(RefSeq) probable leucine-rich repeat receptor-like protein kinase At1g68400
Organism
vun  Vigna unguiculata (cowpea)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRRNT_2 LRR_4 PRIMA1 Insulin_TMD LRR_8
Motif
Other DBs
NCBI-GeneID: 114181695
NCBI-ProteinID: XP_027924020
Position
4
AA seq 619 aa AA seqDB search
MSLAFTISFLYVVLFVSFKSNMVLCVEIEEFFPEERDALILIRDSLNSSVNLHGNWTGPP
CINNLSRWIGITCSNWHVVQIVLEGVNLSGFLPPTFLQNITLLSQLDFRNNALFGSLPSL
KNLVFLEQALLSFNHFSGSIPVEYVELTSLRVLELQENYLHGQIPPFDQPSLTSFNVSYN
HLSGPIPETSVLLRFPESSYGNNSDLCGEPLDKLCPIEPPAPSPAPFSAPPPFAMPPIPA
MKPNNRFQAWSIAVIGAAAALILLSLIMLIAFLFRKRQTSGKEVRRNDSAGHVFGAWAKK
MVAYAGGSDVSERLGRLEFSNKKLPVFDLDDLLRASAEILGRGNLGITYKATLETGTVVA
VKRLNHMNELSKKEFLQQIQLLGQMKHENIAEIISFYYSEEQKLVIYEFTSDGTLFELLH
EGRGVGRMPLDWTTRLSIIKDIAKGLLFLHHSLPSQKVPHANLKSSNVLIHQDTKGYHSK
LTDYGFLPLLPAKQNAEKLAIRRSPEFVQGKKLTRYADVYCFGIIVLEIVTGKIPGHIIG
EIEETTNDLSDWVRTVVNNDWSTDILDLEILAEKEGHDAMLKLTELALECTDMTPEKRPK
MSVVLVRIEEIEKMKKEND
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgagcttggcctttaccataagctttttgtatgtggtcttgtttgtgtcattcaaatcc
aacatggtgttgtgcgttgaaattgaggagttctttccagaagaaagagatgctttgata
ctcataagggattctttgaattcatctgtgaatttgcatgggaattggacaggccctcct
tgtataaacaatctgagtaggtggattggaatcacttgctcaaattggcatgttgttcaa
attgttcttgaaggagttaacctcagtggttttctacctcccacatttcttcagaacata
actctcttgagccaacttgacttccgaaataatgcactttttggatcattgccaagcctc
aagaatctggtgtttttggaacaagcccttttatccttcaatcatttctcagggtcaatt
cctgtggagtatgttgaacttaccagtctaagagtgttggagctgcaagagaattactta
catggtcaaattccaccctttgatcaaccatcattgacaagtttcaatgtgtcatataat
catctgtcagggcctattcctgaaacttctgtgctgctgaggttcccagagagttcttat
ggcaataattcagatctttgtggagagccattggataagttatgtcctattgaacctcct
gcaccatctccagcaccattttctgcaccacctccttttgctatgcctccaattccagca
atgaagccaaataacaggtttcaagcatggagtattgctgtgattggtgctgcagctgca
ctgattcttctttctctgatcatgctcattgctttcttgtttcgtaaaagacaaacaagt
ggaaaagaagtaagaagaaacgattcagctggccatgtttttggggcatgggcaaagaag
atggtggcttatgctgggggcagtgatgtttctgagagattaggcagattggaattttct
aacaagaaactgccagtttttgacttggatgatttattaagggcatcagcagaaattctg
ggaagagggaacttaggtattacgtacaaagcaacacttgaaactggaactgttgttgca
gtgaagagacttaaccacatgaatgaactgagcaagaaagaatttctccagcagatacaa
ttactaggacagatgaagcatgaaaacatagcagaaataatctcattttattattcagag
gagcagaagttggtcatatatgaattcacctctgatggcactttgtttgaactgctacat
gagggtagaggagttggaagaatgccacttgattggaccacaagactttctatcatcaaa
gacatagcaaaaggtcttctttttcttcatcattccttgccttctcaaaaggttcctcat
gccaacctcaaatcatccaatgttctaattcatcaagatactaaagggtaccattccaag
ctcacagactatggtttcttgcctctactcccagccaaacagaatgcagaaaaactagcc
ataagaaggtcaccagaatttgttcaagggaagaagctcacacgctatgctgatgtttat
tgctttggcatcattgtgctagagattgtaactggcaaaatccctggccatatcataggt
gaaattgaggaaacaaccaatgatctttcagattgggtaagaactgtggtgaacaatgat
tggtccacagatatattggatttagaaatacttgcagaaaaagaagggcatgatgcaatg
ttaaagctaacagagttagctctagagtgtactgatatgacaccagagaagaggcctaaa
atgagtgtagtgttggtgagaatagaagagatagagaaaatgaaaaaggagaatgactaa

DBGET integrated database retrieval system