KEGG   Vigna unguiculata (cowpea): 114185030Help
Entry
114185030         CDS       T06017                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
vun  Vigna unguiculata (cowpea)
Pathway
vun03040  Spliceosome
vun04141  Protein processing in endoplasmic reticulum
vun04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:vun00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    114185030
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114185030
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114185030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vun01009]
    114185030
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:vun03041]
    114185030
   03009 Ribosome biogenesis [BR:vun03009]
    114185030
   03110 Chaperones and folding catalysts [BR:vun03110]
    114185030
   04131 Membrane trafficking [BR:vun04131]
    114185030
   03051 Proteasome [BR:vun03051]
    114185030
   03029 Mitochondrial biogenesis [BR:vun03029]
    114185030
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vun04147]
    114185030
Protein phosphatases and associated proteins [BR:vun01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     114185030
Spliceosome [BR:vun03041]
 Complex B
  Other components
   Prp19 complex
    114185030
 Complex C
   Prp19-CDC5 complex
    114185030
Ribosome biogenesis [BR:vun03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    114185030
Chaperones and folding catalysts [BR:vun03110]
 Heat shock proteins
  HSP70 / DNAK
   114185030
Membrane trafficking [BR:vun04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    114185030
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    114185030
Proteasome [BR:vun03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    114185030
Mitochondrial biogenesis [BR:vun03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    114185030
Exosome [BR:vun04147]
 Exosomal proteins
  Proteins found in most exosomes
   114185030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DDR DUF4604 FGGY_C SecD-TM1 DUF357
Motif
Other DBs
NCBI-GeneID: 114185030
NCBI-ProteinID: XP_027928318
Position
5
AA seq 623 aa AA seqDB search
MAKDKGIAIGIDLGTSYSCVAVWQEQHNRVEIIHNDQGNRTTPFFVAFTYDQRLIGEAAK
NQAATNPENTVFDAKRLIGRKYSDPITQSDKMLWPFKVIADDDDKPLIVVEHKDKKKHLS
AEEISSMILMKMREIAEAYLETHVKNAVVTVPAYFNDSQRKATVDAGTIAGLNVIRIINE
PTAAAIAYGLDKRTDCVGERNIFIFDLGGGTFDVSLLTIKDKVFCVKATAGNTHLGGEDF
NNRMVKYFVNEFKRKKKVDISGNPRALRRLRTACDKAKRTLSFAVTAYIEVDSLFEGIDF
CSSINRAKFEELNMDLFEECLNTVQKCFTDAKMNKRSVHDVVVVGGSSRIPKIQQLLQDF
FEGKDLCKSINPDEAVAYGAAVQGAMLSEGIKNVPNLVLLDVTPLSLGISTKGDLTSVVI
PRNTVIPVKKTQIYHTAEDNQFSAYIEVYEGERTGASDNNLLGFFTLSGLSPAPRGHPLD
VCFTIDANGTLSVSAEDPSAGYKNEITITNDQNRLSAGEIKRMIQEAENYQAEDRKFMKK
ANAKNALDDFVYKMKNALKNRNISSKLCAQDREKINYAVKNAAKLLDEDNQQHGIELIED
NLNEDNRLDEYKLASNCYYLNNV
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagataagggaatcgccataggaatcgaccttggtacatcctactcgtgtgtt
gcagtgtggcaggagcaacacaatagagtagaaataattcacaacgaccaagggaacaga
actacacctttttttgttgctttcacatatgatcagaggttgattggtgaagctgctaag
aatcaggctgcaaccaacccagaaaacactgtttttgatgccaagaggttaatcggaagg
aaatatagcgatcccattactcaaagtgataaaatgttgtggccattcaaggtcattgct
gatgatgatgacaaacccttgattgtggttgagcacaaggacaagaagaagcacctctca
gctgaggagatatcatccatgatcctcatgaagatgcgggagattgctgaggcatattta
gaaacgcatgtgaagaacgctgttgtcactgtacctgcttatttcaacgactctcaacga
aaagctactgtagatgctggaaccattgctggccttaatgttattcggataatcaatgag
cctactgcagcggctattgcatatgggcttgacaagagaactgattgcgttggagagcga
aacatattcatcttcgaccttggtggtggtacttttgacgtttctctccttacaattaaa
gataaggtcttctgtgtgaaggctactgcaggaaatactcaccttgggggagaggacttc
aacaacagaatggtgaagtactttgtaaatgagttcaagagaaagaagaaggtggacatt
agtggtaaccctagagctttaagaaggctgagaacggcctgcgacaaggcaaaaaggaca
ctctcgtttgcagttactgcttacattgaggttgattctttatttgaaggcattgatttc
tgctcttcgatcaaccgagcaaagtttgaggaactcaacatggatctttttgaggaatgt
ctgaatactgtacagaaatgttttacggatgctaaaatgaacaaaagaagtgtgcatgat
gttgttgtcgttggaggttcttctaggattcctaaaatacaacagctgttacaggacttc
ttcgaagggaaggatttgtgtaagagcatcaaccctgatgaggctgttgcttatggagcc
gcagttcagggtgctatgttgagtgaaggtatcaagaatgttccgaatttggttttgttg
gatgttaccccgctgtctcttggtatatcaacaaagggagatctcacgagtgttgttatt
cctaggaatactgttattccagttaagaagacccaaatatatcatacagcagaagataac
caattctctgcgtacattgaggtttatgaaggtgagagaaccggtgcaagtgacaacaat
ttgttaggtttcttcactctttctgggttgtctcctgctcctcgtggccatcctttggat
gtttgctttaccatagatgcaaatggcaccctgtctgtttctgctgaggatccaagcgca
ggttataagaatgagattaccataactaatgatcaaaacagactttcagcaggagaaatt
aaaagaatgattcaggaagctgaaaattaccaagctgaagatagaaaattcatgaagaag
gccaatgcaaaaaatgctttggatgacttcgtttacaagatgaagaatgcattgaagaac
agaaatatcagttcaaaactttgtgcacaagatagggagaaaatcaactatgcagttaag
aatgctgcaaagttgcttgatgaagataaccaacagcatggaatagagttgattgaggat
aatctgaatgaggataatcgtttagatgaatacaaacttgcttctaattgttattatctg
aacaatgtttaa

DBGET integrated database retrieval system