KEGG   Vigna unguiculata (cowpea): 114186687Help
Entry
114186687         CDS       T06017                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL2
Organism
vun  Vigna unguiculata (cowpea)
Brite
Enzymes [BR:vun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114186687
Protein kinases [BR:vun01001]
 Serine/threonine kinases: TKL group
  IRAK family
   114186687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase PIP49_C
Motif
Other DBs
NCBI-GeneID: 114186687
NCBI-ProteinID: XP_027930464
Position
6
AA seq 383 aa AA seqDB search
MGNTCAKGKPIAHVSSSNFSGSKRPASKPRQYSNSSAQNQAPKSSESIVTASISSSLKSF
SLNDLKEATKNFRRENLIGEGGFGRVFKGWIDENTYGPTKPGTGIVVAIKNLKPESFQGH
KEWLAEVSYLGQHQHDNLVKLIGYCLEGKNRLLVYEFMQKGSLENHLFRKGVQPMAWVTR
VNIAIGVARGLAFLHSLDQNVIFRDLKASNILLDSDFNAKLSDFGLARDGPTGDNTHVST
RVIGTQGYAAPEYVATGHLAPRSDVYSFGVVLLELLTGRRAVEDDRPGFSDETLVDWAKP
FLSDNRRVLRIMDTRLGGQYSKKGAMAAAALALQCLNTDPKFRPPMVEVLAALEVLNSSN
SFTRTPPRPESHATKNPAGHSQK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatacttgtgccaaaggaaaaccgattgctcatgtatcttcctccaatttttct
ggaagtaagaggcctgcaagtaagccaaggcagtattcaaattcttctgctcaaaatcaa
gctccaaaatcttcagaatcaattgttaccgcatccatctctagtagcctaaagtccttc
agcttgaatgatctaaaggaggccactaagaatttcaggagagaaaatttgatcggagag
ggaggatttgggcgtgtcttcaaaggatggattgatgagaacacatatggccccacaaaa
ccaggcaccggaattgtggtggccattaaaaatcttaaaccagaaagcttccaaggccac
aaggaatggcttgcagaagtcagttatcttgggcagcatcagcatgacaatttggtgaaa
cttattggttattgtttggaaggtaaaaacaggcttctggtttatgagttcatgcaaaaa
ggaagtttggagaatcatctattcagaaaaggtgttcaacctatggcttgggttacaagg
gtcaacattgcaattggtgtagcaagaggactagcgttcttacattccctggatcaaaat
gtcatctttcgtgatttgaaggcttccaatatcctacttgattcagacttcaatgcaaag
ctttcagattttggcttggcaagggatggtccaaccggagataatactcacgtttcaact
cgagtaataggaactcaaggctatgctgcaccagagtatgttgctacaggtcacctggca
ccaaggagtgatgtatacagctttggtgtggtgttgttagagttgcttactggtaggcgt
gctgtggaagatgacagacctggattttcagatgaaactttggtggattgggcaaagcca
tttttgagtgacaacagaagagttttgagaataatggacacaaggttggggggtcaatac
tctaagaaaggggcaatggctgcagctgcacttgcactgcaatgtctcaacactgacccc
aaatttagaccccctatggtggaagttctagcagcattggaagtgcttaattcctcaaac
tcattcacaagaacaccaccaagacctgagagccatgcaaccaaaaatcctgctggccat
tctcaaaagtaa

DBGET integrated database retrieval system