KEGG   Vigna unguiculata (cowpea): 114187113Help
Entry
114187113         CDS       T06017                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1 isoform X1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
vun  Vigna unguiculata (cowpea)
Pathway
vun00260  Glycine, serine and threonine metabolism
vun01100  Metabolic pathways
vun01110  Biosynthesis of secondary metabolites
vun01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vun00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    114187113
Enzymes [BR:vun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     114187113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_3 Pyridoxal_deC Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 114187113
NCBI-ProteinID: XP_027931048
Position
6
AA seq 367 aa AA seqDB search
MEFESNNEKMVAKIVDLRSDTVTKPTEAMRGAMAIAEVDDDILGRDPSCVRLETEMAKLL
GKEAAVFVPSGTMANLISVLVHCDIRGSEVILGHDSHIHIYENGGIATLGGVHPRTVKNN
EDGTMDIALIEAAIRDPKGELVYPTTRLICLENTHGNCGGRCLSVEYTDRVGEVAKKHGL
KLHIDGARIFNASVALGVPVDRLVQAADSVSVCLSKGLGAPVGSVIVGSNSFISKARRLR
KTLGGGMRQVGILCAAALVALQENVEKLESDHKKAKLLADGLNEIKGLRVNTSAVETNMI
YVEIEEGSGITASKLCKDLEDYGILLMTLGSSRLRIVFHHQISGSDVEYTLWCFQEAVNG
VRNENGK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgaatccaataatgagaaaatggtagctaagatagttgatcttcggtcagat
acagtgacaaaaccaactgaagcaatgcgaggtgccatggcaattgctgaggttgatgat
gatattcttggacgtgacccctcctgtgttcggttggagacagagatggcaaagttgttg
ggaaaggaagctgcagtttttgttccatcaggcaccatggccaaccttatatctgtgctt
gtgcactgtgacattagagggagtgaagttattcttggacacgattcccacatacacatt
tatgagaatggaggcattgcaaccctcggaggggtgcatccaagaacagttaagaacaat
gaagatggcacaatggacattgctttgatcgaggctgcaatcagagatccaaagggagaa
ttggtatatccaaccacaaggcttatttgcttggaaaatactcatggaaactgtggtggt
agatgtctttctgttgaatacacagacagagtaggagaggttgctaaaaaacatggattg
aagcttcacattgatggagccagaatatttaatgcatcagttgcactaggtgtcccggtg
gataggcttgttcaagcagctgattcagtttcggtatgtctgtcaaaaggccttggtgct
ccagttggatcagtgattgttggttccaatagctttatcagcaaggctagaaggctgaga
aaaaccttaggtggtggaatgaggcaagttggtatcctttgtgcagctgcacttgttgct
ttacaggaaaatgttgaaaagctagaaagtgatcacaagaaagctaaacttttggctgat
ggattgaatgaaattaaaggccttagagtgaacacctctgctgtggaaaccaatatgata
tatgtcgaaattgaagagggctcaggaattacagcatcgaagctgtgcaaggacttggaa
gactatggtattcttctcatgacacttggctcatcaagattgagaattgtgttccaccac
caaatatctggaagtgacgttgagtacaccttgtggtgctttcaggaagctgtgaatggt
gtacgaaatgaaaatgggaagtaa

DBGET integrated database retrieval system