KEGG   Vigna unguiculata (cowpea): 114187276Help
Entry
114187276         CDS       T06017                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
vun  Vigna unguiculata (cowpea)
Pathway
vun03040  Spliceosome
vun04141  Protein processing in endoplasmic reticulum
vun04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:vun00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    114187276
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114187276
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114187276
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vun01009]
    114187276
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:vun03041]
    114187276
   03009 Ribosome biogenesis [BR:vun03009]
    114187276
   03110 Chaperones and folding catalysts [BR:vun03110]
    114187276
   04131 Membrane trafficking [BR:vun04131]
    114187276
   03051 Proteasome [BR:vun03051]
    114187276
   03029 Mitochondrial biogenesis [BR:vun03029]
    114187276
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vun04147]
    114187276
Protein phosphatases and associated proteins [BR:vun01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     114187276
Spliceosome [BR:vun03041]
 Complex B
  Other components
   Prp19 complex
    114187276
 Complex C
   Prp19-CDC5 complex
    114187276
Ribosome biogenesis [BR:vun03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    114187276
Chaperones and folding catalysts [BR:vun03110]
 Heat shock proteins
  HSP70 / DNAK
   114187276
Membrane trafficking [BR:vun04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    114187276
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    114187276
Proteasome [BR:vun03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    114187276
Mitochondrial biogenesis [BR:vun03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    114187276
Exosome [BR:vun04147]
 Exosomal proteins
  Proteins found in most exosomes
   114187276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DDR
Motif
Other DBs
NCBI-GeneID: 114187276
NCBI-ProteinID: XP_027931279
Position
6
AA seq 618 aa AA seqDB search
MAKEDQGLAIGIDLGTTYSCVAVWREHHSRVHIIHNDQGNNTTPSSVAFTDQERLIGDAA
KNQAATNPQNTVFDAKRLIGRKYSDPVVQKDMMLWPFKVVAGANDKPMITLNYKGEEKQF
CAEEISSMVLVKMREIAEAYLETKVKNAVVTVPAYFNDSQRKSTIDAGTIAGLNIMRIIN
EPTAAAIAYGLDRRMNCVGERNIFIFDLGGGTFDVSILTIKGKIFEVKATAGNTHLGGED
IDNRMLNYFVEKIKKEKKEDISGNPRALRRLRSACERPKRTLSLAVTASIEVDGLSNGID
FRSSITRARFEEINMELFNQCMETVDRCLADAKMHKCSIHDVVLVGGSSRIPKVQELLKD
FFEGKDLCKSINPDEAVAYGAAVQGALLSEGIKNVPDMVLLDVTPLSLGKHVLGDIMSVM
IPRNTTIPVKRTKEYLTVADDQSCVKIQVYEGERTRASDNNLLGSFMLSGFPPAPRGHRF
DVCFAIDENGILSVSAKENTTGISNKIIITNDNERLSTEEINRMIQEADDYQAEDMKFLR
KAKARNKIDDYAYKLKNALKNENFSSKLFSEDREKISSAITKATELIDGDQQEEEIDVFE
DHLEELINVFKRFVGKSD
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagaagatcagggacttgccataggaatcgaccttggcacaacctactcatgt
gttgctgtatggcgggagcatcactctcgagtgcatatcattcacaatgaccaaggcaat
aacaccactccttcttctgttgctttcacagaccaagaaaggttaatcggtgatgctgct
aaaaaccaggctgccaccaatccacaaaacactgtctttgatgctaaaagattgatcggt
agaaaatatagtgatcctgttgttcagaaagacatgatgttatggccattcaaggttgtt
gctggggctaatgacaaaccaatgatcacccttaactataagggtgaggagaaacaattt
tgtgctgaggaaatttcatctatggtcctggtgaagatgagagagattgcagaggcctat
ttggaaactaaagtgaagaatgcggtggttactgtccctgcttatttcaatgactctcag
cgtaagtctaccatagatgctggaaccattgctggccttaacatcatgcggataatcaac
gaaccaactgctgcagctattgcatatggtcttgatagaaggatgaattgtgttggagag
agaaacattttcattttcgatcttggtggtggtacttttgacgtttctatcctaaccatt
aagggtaagatctttgaagttaaggcaacagctggaaacactcatcttggaggagaggac
attgataacagaatgttgaactactttgtggagaaaataaagaaggaaaagaaagaggac
attagtggaaacccgagagccttaaggaggttgaggagtgcatgtgagaggccaaaaagg
acactgtcacttgccgtcactgccagcattgaagtagatggtttatctaatggcattgac
ttccgttcttcaatcactcgtgcaagatttgaggaaatcaatatggaactcttcaaccag
tgtatggagacagtagataggtgtcttgctgatgctaaaatgcataagtgcagtatacat
gatgttgttcttgttggtgggtcttctaggattcccaaagtgcaagagctattgaaggac
ttctttgagggaaaggatttgtgcaaaagcataaaccctgatgaagctgtagcatatggt
gctgctgtgcagggtgctttgttgagtgaaggtattaaaaatgttccggatatggtgttg
cttgatgtaacacctttatcactcggtaagcatgtattgggagatatcatgagtgtaatg
attccaaggaatactactattcctgtaaagaggacaaaagaatatttgacagttgcagat
gaccaatcatgtgttaaaattcaggtttatgagggtgagaggacaagagccagtgataac
aatttgttgggttctttcatgctttccggctttcctccagctcctaggggccatcgtttt
gatgtgtgctttgccatagatgaaaatggtatactatctgtctctgctaaggaaaataca
actggcatcagcaataaaatcatcataaccaatgacaatgaacgactgtcaacggaagaa
atcaatagaatgattcaagaagcagatgattatcaagctgaagatatgaaattccttagg
aaggccaaagcaaggaataaaattgatgactatgcttacaagctaaagaatgctttgaaa
aatgaaaatttcagttcaaaacttttctcagaagacagggaaaagatcagttctgcaatt
actaaggccacagagttaattgatggtgatcagcaggaggaggaaatagatgtgtttgag
gatcatctggaagagcttattaacgtctttaaacgctttgtcggaaagtctgattag

DBGET integrated database retrieval system