KEGG   Vigna unguiculata (cowpea): 114187656Help
Entry
114187656         CDS       T06017                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL26 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
vun  Vigna unguiculata (cowpea)
Brite
KEGG Orthology (KO) [BR:vun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vun01001]
    114187656
Enzymes [BR:vun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114187656
Protein kinases [BR:vun01001]
 Serine/threonine kinases: TKL group
  IRAK family
   114187656
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 114187656
NCBI-ProteinID: XP_027931764
Position
6
AA seq 375 aa AA seqDB search
MNCFPCFSKTKKCNSKREQQPTTQPENVIATKPPDVRKPKADDPNNVDTTNIQAQNFTFR
ELAIATKNFRQECLMGEGCFGRVYKGTIPATGQVVAVKQLDRNGVQGSKEFLVEVLMLSL
LNHENLVKLTGYCADGDQRLLVYEFMPGGSLEARLLERKPDEPPLDWYSRMKIASHAAKG
LWYLHDKANPSIIYRDLKSANILLGDDFSAKLSDYGLAKLAGNDKANIVPTRVMGTYGYS
APEYVRTGNLTLKSDVYSFGVVLLELITGRRAVDTTRSHDEQNLVSWAQPIFRDPKRYPD
MADPNLNNDFPEKDLNQVVAIAAMCLQEEAAARPLMSDVVTALSFLSTANTEGGADNSSY
SGGDSDDSGSAKKQS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaattgttttccgtgtttttcaaagactaagaaatgcaatagcaagagggagcagcaa
ccgaccacacaaccagaaaacgttatagcaacaaaacctccggacgtaagaaaaccaaag
gcagatgatccaaacaacgttgacactacaaatattcaagcacaaaatttcacgttccgt
gaactagccatcgcgacgaagaatttccgacaagaatgtttgatgggtgaaggttgcttt
ggcagagtttacaagggaacaattcctgcaaccgggcaggtggtagcagtgaagcaactt
gaccgaaatggggtacaaggaagtaaggaatttctggttgaggttttgatgttaagcctc
ttgaaccatgaaaacctcgtcaaactcactggttattgtgctgatggagatcaacgtctt
ctggtgtatgagttcatgccaggtggctctttagaagcccgtcttcttgagaggaaacca
gatgaacctccattagattggtacagcagaatgaaaatagcatcacatgctgcgaaagga
ttgtggtacttgcacgacaaggccaacccttcaattatataccgagacttgaaatctgca
aacatcttgctaggtgacgatttcagtgcaaaactatcagattatggattggccaaactt
gctggcaacgataaagcgaacattgtacccacaagagttatgggcacttatggttacagt
gctcctgagtacgtaagaacaggtaacctcacattgaaatcagatgtctacagttttgga
gttgtcttgctagagctcattaccggacggcgcgcggttgacaccacaagatcacacgat
gagcaaaacctagtttcatgggcacaacccatatttagggatccaaagagatatccagat
atggcagatccaaatttgaataatgatttcccagaaaaggatttgaaccaagttgttgca
atagcagcgatgtgcttgcaggaggaagcagcggcgcgtcctttgatgagtgatgttgta
actgctctgagttttctttccactgccaatacagagggtggtgccgacaacagtagctac
tccggtggagacagcgatgacagtggatctgctaaaaaacagtcttga

DBGET integrated database retrieval system