KEGG   Vigna unguiculata (cowpea): 114190259Help
Entry
114190259         CDS       T06017                                 

Definition
(RefSeq) nitrilase-like protein 2
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
vun  Vigna unguiculata (cowpea)
Brite
KEGG Orthology (KO) [BR:vun00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    114190259
Enzymes [BR:vun01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     114190259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 114190259
NCBI-ProteinID: XP_027934872
Position
7
AA seq 315 aa AA seqDB search
MYMHCVQVSAIGGFASPIPKSSVSLWSTTMAVASPNSLRVAAAQMTSVSDLAANFATCSR
LVKEAASAGAKLLCFPEAFSYVGTKDGDSVSVAQPLDGPIMNQYCSLARESSIWLSLGGF
QEKGSDPTHLCNTHVIVDETGKIRSSYRKIHLFDVDVPGGRVYKESKFTEPGKDIVAVDS
PIGRLGLSVCYDLRFPEMYQLLRFQHEAQVLLVPSAFTKVTGAAHWEILLRARAIETQCY
VIAAAQTGKHGDKRESYGDTLIIDPWGTIVGRLPDRLSTGIVVADIDLSLVDSVREKMPI
DKQRMPIDFWKAASL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtatatgcattgcgtgcaagtgagtgctattggtggatttgcttctcccattcccaaa
tcatcagtttcactttggtcaacaaccatggctgtggcttctcctaactcactccgagtt
gcagcggcccagatgacatcggtcagcgacctcgccgccaatttcgccacctgctctcgc
cttgtcaaagaagcagcttcagctggagccaaattgctttgctttcccgaggccttctct
tatgtgggtaccaaggatggggacagtgttagtgttgctcaaccattggatggaccaatt
atgaaccagtattgctctttggccagagaatccagcatttggttgtcacttggaggcttc
caagagaaaggatcagatcctacccacttgtgtaatactcatgttatagtagatgagact
gggaaaattagaagctcttatagaaagatacacctgtttgatgtagatgttcctggtgga
agggtatataaagaaagtaaatttacagaaccaggcaaggatattgttgcagtagacagt
cctattgggcgtttgggcctcagtgtatgctatgatttgagatttcctgaaatgtaccaa
ttgttacgtttccaacatgaagctcaggtactgttggtaccttcagcattcactaaagtt
acaggtgctgcacactgggagattctccttcgtgcccgtgcaattgagactcaatgttat
gtcattgctgctgctcaaactggcaaacatggtgataaaagagaaagctatggtgacaca
ttaattatcgatccatgggggacaattgttggtcgattaccagatcgtttgtctacaggg
attgtagtagctgatatcgatttatcacttgttgattcagttagagagaaaatgccaatt
gataagcaaaggatgccaattgacttctggaaagctgcatctctatag

DBGET integrated database retrieval system