KEGG   Vigna unguiculata (cowpea): 114192361Help
Entry
114192361         CDS       T06017                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
vun  Vigna unguiculata (cowpea)
Pathway
vun00480  Glutathione metabolism
vun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vun00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    114192361
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vun02000]
    114192361
Enzymes [BR:vun01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     114192361
Transporters [BR:vun02000]
 Other transporters
  Pores ion channels [TC:1]
   114192361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_N_4 Catalase-rel
Motif
Other DBs
NCBI-GeneID: 114192361
NCBI-ProteinID: XP_027937862
Position
7
AA seq 222 aa AA seqDB search
MGEVRLHGFWYSPFTLRVVWTLKLKDIPYQYIEEDRYNKSLQLLQYNPVHKKTPVLVHNE
KPLCESMIIVEYLDEIWPHNPLLPSDPYNRALARFWVNYTEETFSAGVAFYRSNSDEERE
KSIENLSKHLMVVENQCFGGEKKIFGGEVINIVDIAFGSMFKFFEVAEDIIGVKVLQDEK
FPQLCSWYNNFKNIPVIKENLPDHQKQVATINSIREKRLASS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgggagaggtgaggcttcatgggttttggtatagtccctttactttgagggtggtatgg
accttgaagttaaaggatataccatatcagtatatagaggaagatcgctacaacaagagt
cttcaacttcttcaatacaacccggtgcacaagaaaactccagtgctggttcataatgaa
aaacctttatgtgagtccatgattattgttgaatacttagatgagatttggccacataac
ccattgcttccttctgatccctacaacagagctttggcacggttttgggttaattatact
gaagaaacgttttctgcaggtgtggcattctaccgtagcaattctgatgaagaacgagaa
aagagcatagagaatctttcgaagcatctcatggttgttgagaatcagtgttttggtggt
gagaagaaaatttttgggggagaagttattaacattgtggacatagcttttgggtccatg
ttcaaattttttgaggttgcagaagatattattggagtgaaggttcttcaagatgagaaa
ttccctcagctgtgttcctggtataataatttcaagaatattcccgttattaaagaaaat
ctcccagaccatcagaaacaggtagctactatcaatagtatcagagaaaaacgtttggca
tcttcctaa

DBGET integrated database retrieval system