KEGG   Vigna unguiculata (cowpea): 114193671Help
Entry
114193671         CDS       T06017                                 

Definition
(RefSeq) putative wall-associated receptor kinase-like 16
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
vun  Vigna unguiculata (cowpea)
Brite
KEGG Orthology (KO) [BR:vun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vun01001]
    114193671
Enzymes [BR:vun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114193671
Protein kinases [BR:vun01001]
 Serine/threonine kinases: TKL group
  IRAK family
   114193671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind EGF_CA EGF_3 DUF4441 EGF
Motif
Other DBs
NCBI-GeneID: 114193671
NCBI-ProteinID: XP_027939359
Position
8
AA seq 664 aa AA seqDB search
MATMRLKEMQKQLTRLTVLLVMALTAASQAQPGCPDSCGSVSSIPYPFGIGTSSVNGENC
FLEKDLNLTCTDSTLYRGQGNVQILNISLAGKIDMLVHISKVCKNELLGGVKTQGNLPSL
RTPAFAISSEDNKFVTVGCDTYGYLNTFRNGTQSSTGCLTRCDSIESVQSRQRSGNCTGI
GCCQVDIPPGMKNISFQASTFKNFNSTSDIPECTNNEHTCDSKDHCRETLGSFECFCPDG
LIGDGTREGGGCHTRQKADAFTKIIIGAGVGLIALFIGIFWLYLIYEKRKVFKLKQKFFQ
QNGGIILRQQLSTREDSSHTTTIFNAEELKKATNNFDESLIIGKGGYGTVFKGVLSNNKV
VAIKKSKIVDQSQVQQFINEVIILSQINHRNVVKLLGCCLETEVPLLVYEFVNNGTLFDY
LHNQGHRVNVSWKMRLRIATEAVAALSYLHSAASIPIRDVKTSNILLDDNYTAKVSDFGA
SRLVPIEQTEIATIVQGTFGYLDPEYMQSSQLTEKSDVYSFGVVLVELLTREKPFSFDKT
EEKRSLTVHFLCSLKEDRLFDVLQVGLLDEENQQEIMEVAILAARCLRLIGEERPSMKEV
TMELEGIQLTKKHLWINTGKNFEESQYLLHETQSSYEHGDSSGQQNIEYDSLREHELIDF
GNGR
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaatgagattgaaggagatgcagaagcaactgaccagactgaccgtgctgtta
gtgatggctttaactgccgccagccaagcccagcccggctgcccggactcctgcggaagt
gtttcatcgattccgtatccattcggcatcggcacttcttccgtcaacggtgaaaactgt
tttctggagaaagatttgaatctcacatgcacagactcaaccttatatcgcggtcaaggt
aacgtccaaattctcaacataagcctcgccggtaaaatcgacatgctcgtccacatctcc
aaggtctgcaaaaacgaattgttgggtggagtaaaaacacaaggtaaccttcccagtctc
agaacaccggctttcgccatttctagtgaggacaacaagttcgtaaccgtaggctgcgac
acctatggctatctcaacactttccgcaacggcacacaatcttcaacggggtgtttaacc
agatgcgacagcatagagagcgtccaaagcaggcagagaagcggaaactgcaccggcata
gggtgttgccaggtcgacattcctcctggcatgaagaacatcagtttccaagcttccact
ttcaaaaatttcaattccacttctgacattccggagtgtacaaataacgaacacacctgc
gatagtaaagatcattgtcgtgaaactcttggctcttttgaatgtttctgtcctgacgga
cttattggagatggaacaagagaaggcggtggatgccacacaaggcagaaggctgatgca
tttacgaagatcatcattggtgcaggggtaggattaattgctctattcataggaattttt
tggttgtacttgatatacgagaaaaggaaagtcttcaaattgaagcagaagttttttcaa
cagaacggaggcattattcttaggcaacaactctccacaagagaagactcatctcatacc
actacgattttcaatgctgaagaacttaagaaagccaccaacaactttgatgagagctta
atcataggtaaaggaggttatggtacagttttcaaaggagttctatcaaataacaaagtt
gtagctatcaaaaagtccaaaatagtggatcagagccaggtacaacaattcataaatgag
gtcattatattgtcacaaattaatcacaggaatgtggtcaaactcttgggatgttgttta
gagacagaagttcctttattggtctatgaatttgttaacaatggcacccttttcgattat
ttacataatcaaggccatagggttaacgtgtcatggaaaatgcgtctaaggatagctaca
gaagcagttgcagctctgtcatatctgcactcagcagcttccatacccatcagagacgtg
aagacttctaacatactcttagatgacaattacactgccaaagtctctgattttggagct
tcaagattggttccaattgagcaaactgagatagccacaattgtgcaagggacctttggg
tatttagacccagagtacatgcaatcaagccagttgacagaaaagagtgatgtttatagt
tttggggtagtgcttgtagaacttcttacaagggagaaacctttctcttttgacaagaca
gaagagaaacgaagtcttacagttcactttctttgtagcttgaaagaggatcgtctgttt
gatgttcttcaggtgggtcttttggatgaagaaaaccaacaagaaattatggaggttgct
attcttgctgccagatgcttgagacttataggggaggaaagacctagcatgaaggaagtg
acaatggaactagagggaatacaacttacaaagaaacacctttggatcaatacaggcaaa
aactttgaggagagtcaatacttgcttcatgagacacaaagctcttatgaacatggtgat
agtagtggccaacaaaatattgaatatgatagcttgagagaacatgaattaattgacttt
ggtaatggaagatga

DBGET integrated database retrieval system