KEGG   Vigna unguiculata (cowpea): 114194845Help
Entry
114194845         CDS       T06017                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
Organism
vun  Vigna unguiculata (cowpea)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 114194845
NCBI-ProteinID: XP_027941056
Position
8
AA seq 652 aa AA seqDB search
MWREIAVTVLVFLLHQINGEDYGCSPSSCGKIRNISYPFRLKGDPEKCGPYELSCENNIT
LLSLLSGRFNVEAINYNNFTMRVVDPGLQQSNCSSLPRYFLSPSNFTDSHTDTLDMYETQ
YIVFLSCSHGVSGKRKYVDTGGCLNWDSKGYTYAMAGDLLAEDLEVGCDVKLVAPTSWWG
LDTNNYSYAMIHTSLLYGFHLFWLPLVCKDRCGFGNNDCHFNYSTQSAECYPGLILPIFR
PERYGGTYITKDVGYAITLEPKLVNLGRCVRYFLYRYVAGMILFIALLIYKWKRRHSSIY
ENIENYLEENSLMPIRYSYKEIKKMATGFNEKLGEGGYGSVFKGKLRSGPCVAIKVLRKS
KGNGQDFINEVATIGRIHHHNVVHLIGYCAEGSKRALVYEFMHNGSLDKFIFSKEGNTHL
TYDTIHDIAIGVAHGISYLHHGCDMQILHFDIKPHNILLDEKFTPKISDFGLAKLYSTDK
SVVTMTAARGTIGYIAPELFYNNVGRISNKSDVYSFGMFLMEIASKRKNLNPHAEHSSQL
YFPFWIYDQLNKGKDLEMEDVRDFENKIIKKMIIVSLWCIQLKPNDRPSMNKVVEMLEGD
IENLKLPPKPSLYPHETLEDSQRMCSHQTTLSHFVGSSSYSVASNVPLDESI
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgtggagagagatagcagtgacggtgttggtgtttctactgcaccaaataaacggagaa
gattatggttgctccccctcttcctgtggcaaaatcaggaacatatcttatccatttcga
ttgaaaggagacccagaaaagtgcggtccgtatgagctatcttgtgaaaacaatataacg
ctattatctttgctctctggaagatttaatgtggaggccatcaactacaataatttcaca
atgcgagtggtggatcctggacttcaacaatcaaactgctcttcccttcctcgctatttc
ttgtctccatccaattttactgattctcacaccgacaccttggatatgtacgaaactcag
tatatagtgtttttgagttgtagccatggagtgagtgggaagcgaaagtacgtggatact
ggtggatgcctgaattgggactccaaaggttacacatacgctatggctggtgacctatta
gcagaggacttagaagttggttgtgatgtaaagctggttgctcccacatcgtggtggggt
ttggacacaaataattattcctacgccatgatccacacatcgctactctatggatttcac
cttttttggcttcctctcgtctgcaaggatcgttgtggatttggtaataacgactgccat
ttcaattattccacccagagcgctgaatgctatcctggattgattttaccaatatttaga
ccagaacgatatggtggaacttatatcactaaagatgttggatatgccattacgcttgaa
ccaaaattagttaatttgggacgttgtgttcgatacttcttatatagatatgttgctggc
atgatattgtttattgctcttttgatatataaatggaaaagaagacattcatcgatatat
gaaaatattgaaaactatttagaggaaaatagcttgatgcctattcgatattcgtataag
gaaattaagaagatggccacaggtttcaatgaaaaattgggtgaaggaggatatggctct
gtattcaagggaaagttgcgcagtggaccttgtgttgccataaaagtgttacgaaaatca
aaaggtaatggacaagactttatcaatgaagttgcaacaattggaagaatacatcatcac
aatgtagtgcatttaattggatattgtgctgaaggctcaaaacgtgcccttgtttacgag
ttcatgcataatggatctcttgataaatttatattttctaaagaaggaaatacgcattta
acctatgacacaatacatgatatagcaattggagtagcacatggaatttcgtatctacat
catgggtgtgacatgcaaattttgcattttgacatcaaaccccacaacatcctacttgat
gaaaaattcactccaaagatttctgactttggattggccaaactatattcaacagacaaa
agtgttgtgactatgacagcagcaagaggaacaattgggtatatagctcctgagttgttt
tataataatgttggaagaatatcaaataaatctgatgtttatagttttggaatgtttttg
atggaaatagcaagcaagaggaaaaacctaaacccccatgcagaacattcaagtcaactt
tactttcccttttggatttatgatcaacttaataaagggaaagatttagaaatggaagat
gtcagagattttgagaacaaaattataaaaaagatgatcattgtttcactttggtgtata
cagttgaaaccaaatgaccgtccttccatgaataaagtagtggaaatgcttgaaggagac
attgaaaacctaaaattacctccaaaaccttctttgtatccacatgaaacattggaagat
agccaaagaatgtgctctcaccaaacaacattgtcccactttgttggttcttcaagttat
tctgtagcctctaatgttccactagatgaaagtatttga

DBGET integrated database retrieval system