KEGG   Vitis vinifera (wine grape): 100232951Help
Entry
100232951         CDS       T01084                                 

Gene name
CWINV
Definition
(RefSeq) cell wall apoplastic invertase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00052  Galactose metabolism
vvi00500  Starch and sucrose metabolism
vvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100232951 (CWINV)
   00500 Starch and sucrose metabolism
    100232951 (CWINV)
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     100232951 (CWINV)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 100232951
NCBI-ProteinID: NP_001268208
UniProt: Q3L7K5
Position
9
AA seq 576 aa AA seqDB search
MATSSHGLLGFFFSRFLGHGFVPLEASPPSLHPTSKISLPSSLKTHQPYRTGYHFQPRKN
WMNDPNGPMIYKGLYHFFYQYNPHGAVWGNIVWAHSTSTDLVNWTPHKYAISPSQPADIN
GCWSGSATILPNGKPVILYTGIDPQNKQVQNMAVPKNLSDPFLLEWTKLSQNPLMEPTTI
NSINASSFRDPTTAWQGTDGRWRVIIGSKIKRKGLAILYRSKDFVRWTKAQHPLHSGKNT
GMWECPDFFPVSINSSTGVDTSSISKTLKYVLKLSLDDTKHDYYTIGSYNREKDTYVPDK
GSVDNDSGLRYDYGKFYASKTFFDNAKNRRILWGWINESSSVEHDIEKGWSGVQAIPRNV
WLDKSGKQLLQWPIAEIEKQRIKPGHMSSRELKGGSKVEVGGITASQADVEISFKISDFK
KAEVFDESWSNPQLLCSQRGASVKGGLGPFGLMVLASKGMEEYTAVFFRIFKRQTKYVVL
MCSDQSRSSLDNDNDKTTYGAFLDVDPVHEKLSLRSLIDHSIVESFGGGGKVCITARVYP
TLAIDGEAHLYAFNKGTGSVGMTTLRAWSMKKAKIN
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggccacctcttctcatggcctattagggttcttcttctctcggttcttgggccatggc
tttgtgccccttgaagcctccccaccaagtctacatcccacctccaaaatcagtctcccc
tcttctttaaaaacccaccagccttacagaactggatatcatttccagcctcgcaagaac
tggatgaatgatcctaatgggcctatgatctacaaggggctctaccatttcttctatcaa
tacaatccccatggtgcagtttggggaaacatagtgtgggcacattccacatcaaccgat
cttgtcaactggactcctcataaatatgccatttccccatcccagccagctgatatcaat
ggctgctggtcaggttcagcaaccatcctgccaaacggcaagccagtgattctctatact
ggtatcgatccacagaacaagcaagttcagaacatggctgtgcccaaaaatctctctgac
cccttccttctagaatggactaagctctctcagaaccctctaatggaacctactaccatc
aacagcatcaatgctagctcattcagagaccctacgactgcttggcagggcactgatgga
agatggagggtgataattggaagcaaaataaagcgaaaaggattagcaattttgtatagg
agcaaagattttgtccgctggactaaagcacaacacccgttacattcagggaagaatact
ggaatgtgggagtgtccagacttttttccagtatctatcaacagctctacgggtgtagat
acatcatcgataagtaaaacccttaaatatgttcttaaattgagcttggatgatactaag
catgactactacacgattggaagctacaaccgtgagaaggatacctatgtcccagataag
gggtctgtggataatgactcaggcttaagatatgattatggcaagttttatgcttcaaaa
accttctttgacaacgctaagaaccgaagaatcttgtggggttggatcaacgaatcatct
agtgtggagcacgatatcgagaagggatggtctggagttcaggcaattccaaggaatgtt
tggctggacaagtctgggaaacagttactgcaatggccgattgcagagattgaaaaacaa
cggattaaaccggggcatatgtctagcagagagctgaagggaggatcaaaggttgaagtt
ggtggaataacagcatcacaggcagatgtggagatatcgtttaagatatcagactttaag
aaagcagaggtttttgacgaaagctggagtaatccacagctgctgtgcagtcaaaggggt
gcatcagtaaaaggtgggctagggccatttggactaatggtgctggcttcaaagggcatg
gaagaatacacagcagttttctttagaattttcaaacgtcagaccaaatatgtggtgctc
atgtgcagtgaccaaagcaggtcgtctttagataatgataatgataagaccacgtatggg
gcatttttggacgtggatcctgtccatgagaagctgtcactaaggagtttgattgatcac
tcaatagtggagagctttggaggaggtggaaaggtttgcataacagctagggtttatcct
acattggctattgacggtgaagcccacttgtatgccttcaacaaaggaactgggagtgta
gggatgacaacactgagagcttggagcatgaagaaagctaaaatcaattga

DBGET integrated database retrieval system