KEGG   Vitis vinifera (wine grape): 100243029Help
Entry
100243029         CDS       T01084                                 

Definition
(RefSeq) mitochondrial cytochrome c
  KO
K08738  cytochrome c
Organism
vvi  Vitis vinifera (wine grape)
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 100243029
NCBI-ProteinID: NP_001267985
UniProt: B2LXS2
Position
18
AA seq 112 aa AA seqDB search
MASFDEAPPGNPAAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSAA
NKNMAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQATA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtttgatgaagcacctcctggcaatcccgctgctggagagaagatcttcaag
accaagtgcgctcagtgccacaccgtcgacaaaggcgctggtcacaagcaaggacccaat
ctgaatggccttttcggtaggcagtctggcacaactcccggttactcgtactctgctgct
aacaagaacatggctgttatttgggaggaaaagacattgtatgactacttgctgaaccca
aagaagtacattcctggaacaaagatggtgttccctggactaaagaagcctcaggatcgg
gccgacttgattgcatatttgaagcaagccactgcttaa

DBGET integrated database retrieval system