KEGG   Vitis vinifera (wine grape): 100243397Help
Entry
100243397         CDS       T01084                                 

Definition
(RefSeq) glutathione S-transferase U9-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00480  Glutathione metabolism
vvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100243397
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vvi02000]
    100243397
Enzymes [BR:vvi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100243397
Transporters [BR:vvi02000]
 Other transporters
  Pores ion channels [TC:1]
   100243397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_N_4 GST_C_3
Motif
Other DBs
NCBI-GeneID: 100243397
NCBI-ProteinID: XP_010663365
UniProt: F6GT86
Position
17
AA seq 236 aa AA seqDB search
MGEENKVTLYGMWASPFVRRVEITLKIKGIPYEYVEEDLRNKSQLLLQYNPVHKKVPVLV
HNGKPIAESLVILEYIEETWKNGPKILPEDPYERAKVRFWASFIQQQARQSLFDSLVSAA
KSSGEAHEKAMKEVFEKLTVFEEGMKDFFPSGTPHFEDENIGFLDIVLCSLFGHHKAQEE
ALGLKIIDPERHPLVYSWVTALNEVPAVKESLPPHDKMVALIQFLRRNAPHRSSEA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgggagaggaaaacaaagtgacgttatatggaatgtgggctagccctttcgtcaggagg
gttgaaattaccctcaaaattaaaggcataccttatgagtatgtagaagaagatttgaga
aacaaaagccagttgctcctccagtacaatcctgtccacaagaaggttcctgtacttgtc
cacaatggaaaacccattgctgaatcattggtcatccttgaatatattgaagaaacctgg
aagaatggtcctaaaattcttcctgaggatccctatgaaagggccaaagttcgcttctgg
gctagctttatccagcaacaggcgagacagtctttatttgatagcttggtctcagcagca
aaaagcagtggggaagcgcatgagaaagccatgaaggaagtgtttgagaaactgactgtt
tttgaagagggaatgaaggacttctttccaagtggcactcctcattttgaagatgagaat
attggtttcctggacattgtattgtgttcgctgtttggccaccacaaagctcaagaagaa
gcccttggtctgaagatcattgatccagaaaggcatccactggtatactcttgggtgaca
gctttgaatgaagtaccagctgtgaaagagtctcttcctcctcatgacaagatggtggca
ttgattcagtttcttaggcgaaatgcccctcaccgatcttctgaagcttga

DBGET integrated database retrieval system