KEGG   Vitis vinifera (wine grape): 100243934Help
Entry
100243934         CDS       T01084                                 

Definition
(RefSeq) probable choline kinase 1
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00564  Glycerophospholipid metabolism
vvi01100  Metabolic pathways
Module
vvi_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100243934
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100243934
    2.7.1.82  ethanolamine kinase
     100243934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Haspin_kinase APH_6_hur Pkinase Choline_kin_N DUF1679
Motif
Other DBs
NCBI-GeneID: 100243934
NCBI-ProteinID: XP_002265759
UniProt: D7SXZ1
Position
18
AA seq 358 aa AA seqDB search
MTVKNNGLSKGCVSEELRKLLISLASSWGDVVDDPKKLRVIPLKGAMTNEIYQINWPIEA
GTRSVLVRVYGEGVEVFFDRDDEIRTFECMSEHGHGPRLLGRFADGRVEEFIHAKTLSAA
DLRDPEISALVAAKLREFHRLEMPGPKNVFLWDRMRNWVGEAKRLSSPKDAKEFCLDTLE
EEISMLQKEFSQDHQDIGFCHNDLQYGNIMIDEKTRAITIIDYEYASYNPVAYDLANHFC
EMVANYHTDTPHILDYSKYPDQEERHRFIRTYLSSAGNQPSDSEVEKLACDAEKYTLANH
LFWGIWGIISGHVNTIEFNYMEYARQRFQQYWLRKPLLLGSSKARSDSVINDSSISPM
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgaagaataatgggttgagtaaaggttgtgtttctgaagaattaaggaaactg
ctgatatcattggcatcaagctggggagatgttgtcgatgacccgaaaaagttgcgggtg
atcccattgaagggtgctatgacaaatgagatttatcagataaattggcctattgaggca
ggcacaagaagcgttcttgttcgggtctatggtgaaggtgttgaggtttttttcgatcgg
gacgatgaaattaggacttttgagtgcatgtctgagcatggacatgggcctcgccttctt
gggaggtttgcagatgggcgtgtggaggagtttatccatgcaaagacactatcagctgct
gatcttcgcgatcccgaaatatctgctctggtagctgctaagttgagagagttccacagg
cttgaaatgccagggcctaagaatgtattcctatgggacagaatgagaaactgggttggt
gaggccaaaagattgtcttctccgaaagacgcaaaggaattctgcttggatactctggag
gaggaaatcagtatgctgcagaaggagttttcacaggaccaccaagacattgggttttgt
cacaatgatttgcagtacggaaacataatgattgatgagaaaacaagggcaatcactata
attgactatgaatatgcaagttacaaccctgttgcctatgacctagcaaatcacttctgt
gaaatggtagcgaattatcatacagatacacctcatatcttagactatagtaaataccca
gaccaggaggagcgccatagattcatccgcacatacctcagcagtgcaggtaaccaacca
agtgacagtgaagttgaaaaattagcctgtgatgcagagaagtacactcttgcaaatcat
ctattttggggcatatggggaataatttcgggtcatgtaaacacgattgaattcaactac
atggagtatgcaaggcagaggtttcagcagtactggctcagaaagcccctgcttttgggt
tcctcgaaagctagatctgatagtgtcatcaatgattcttctatatctcccatgtga

DBGET integrated database retrieval system