KEGG   Vitis vinifera (wine grape): 100244362Help
Entry
100244362         CDS       T01084                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED6, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00906  Carotenoid biosynthesis
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
Module
vvi_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    100244362
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     100244362
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 100244362
NCBI-ProteinID: XP_002283185
UniProt: F6HS58
Position
5
AA seq 575 aa AA seqDB search
MQASPGFSSTAITSAPESPAPTKLHPPPSKLLIQTSNPPLPLKLIAPLTSPLATKWPSHL
NPLQKLAASALDMVECFLIHRLDNKHTLPKPLDPAVQLVGNFAPVRECPVQHDLQVLGQL
PPALRGVYLRNGANPMLSPAGGHHLFDGDGMIHAVTLGPGNRASYSCRFTRTSRLVQEAA
LGRPLFPKPIGELHGHSGIARLALFYARAAVGLVDGSRGTGVANAGLVYFNGRLLAMSED
DLPYHVKIKGDGDLETTGRFDFSGQMDRPMIAHPKVDPITGELFSLSYNVVKKPYLKYYK
FGTCGEKSREVSISLQQPTIIHDFALTETSVVIPDHQVVFKLSEMVRGGSPVIHDPNKIS
RFGVLPRNDPDESRIQWIDVPDCFCFHLWNAWDERSSSGDRIVVVIGSCMSPADSIFKER
VDPLRSELSEIRLNLTTGGSSRRVIVAGMNLEAGQVDKRRLGRRTRYIYLAIAEPWPKCS
GMAKVDLVTGEVTKMMYGEGRFGGEACFVGEEEGGEGEGWLMSIVRDEKRERSELIVVEA
DDIKQVASVRLPTRVPYGFHGTFVDSQQLRAQRVC
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcttctcctggcttctcctccaccgccatcacctctgctcctgaatcacctgct
cctactaaacttcacccaccgccatccaaacttctcatccaaacatcaaacccaccactc
cccctcaaacttattgctccattaacctctccccttgcaactaaatggccttctcacctc
aacccacttcagaaactcgctgcctctgccctagacatggttgagtgcttcctgatccac
cgattggacaacaaacacaccctccccaagcccctcgaccccgctgttcaacttgttggc
aacttcgccccagttcgggagtgtcctgttcagcacgacctccaggtgctgggtcagctt
ccgccagctctccgtggcgtctacttgcgaaacggcgccaatcccatgctctctccagcc
ggtggtcaccacctcttcgacggtgacggcatgatacatgctgttaccttgggcccaggc
aacagagccagctacagctgccggttcacccgcacgagccggctggtgcaggaagccgca
ttaggaaggccgctgtttcccaaaccgatcggtgagctgcatggccactctgggatagct
cggctggcgctgttctacgcccgcgccgcagtaggcttggtggatggatcacgaggcaca
ggtgtcgcaaatgctggcctcgtctatttcaacggtcggcttctcgccatgtcagaggat
gacctgccctaccacgtgaagatcaaaggcgatggagacctggagaccaccggacgcttc
gacttctcaggacagatggaccgtccgatgatagcgcatcccaaggtggaccccataaca
ggggagcttttctctctcagctacaacgtggtgaagaagccctacctcaagtattataag
ttcggcacgtgcggagaaaagtcacgtgaggtatcgatttccctccaacagcccacgatc
atccacgacttcgctttaacggagacctccgtggtgatcccagaccaccaggtggttttc
aaactatcggaaatggttcggggcggctcacctgttatccacgacccgaataagatctcc
cgcttcggagtcctacccagaaacgatcccgacgaatccagaattcagtggatcgacgtc
cccgactgcttctgtttccacctctggaacgcctgggacgagcgctccagctccggtgac
agaatcgtggtggtgattgggtcgtgcatgagccccgcagactcgatcttcaaggaacgg
gtcgacccgcttcggagcgagttatcggagatcagactgaacttaacgacgggagggtca
agccggcgggtaatagtggcggggatgaatctggaagcggggcaagtggacaagcgccgg
ctgggaaggagaacacggtacatatacctggcgatagcagagccatggcccaaatgctcg
ggcatggcgaaggtagatttggtgaccggagaggtaaccaagatgatgtacggcgaggga
aggttcggtggggaggcgtgtttcgtgggggaggaggaaggaggagaaggagaagggtgg
ttgatgagtatagtgagggacgagaagagggagaggtcagagctaatcgtggtggaagct
gacgacattaagcaggtggcttcggtcaggttgccgaccagggttccctacggctttcat
gggacttttgttgattctcaacaattgagggcacagcgtgtctgttaa

DBGET integrated database retrieval system