KEGG   Vitis vinifera (wine grape): 100245397Help
Entry
100245397         CDS       T01084                                 

Definition
(RefSeq) arginase 1, mitochondrial
  KO
K01476  arginase [EC:3.5.3.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00220  Arginine biosynthesis
vvi00330  Arginine and proline metabolism
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
vvi01230  Biosynthesis of amino acids
Module
vvi_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    100245397
   00330 Arginine and proline metabolism
    100245397
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100245397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 100245397
NCBI-ProteinID: XP_010661662
Position
15
AA seq 341 aa AA seqDB search
MRNIARKGIHYWQKLNAANVPAELIENGQNRVIDASLTLIRERAKLKGELVRALGGALAS
SSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNATTEEGKELNDPRVLTDVGDVPVQE
IRDCGVDDDRLMKIISESVKLVMEEDPLRPLVLGGDHSISFPVVRAVSEKIGGPVDILHL
DAHPDIYHSFEGNKYSHASPFARIMEGGYARRLLQVGLRSITSEGREQGKRFGVEQYEMR
TFSRDRHILENLKLGEGVKGVYISLDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNLQA
DVVAADVVEFNPQRDTVDGMTAMVAAKLVRELTAKMSKMKN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatattgcaaggaagggaattcattactggcagaaactgaatgctgcaaatgtc
ccagctgagttgatagaaaatggccaaaatcgtgttatagatgcttcccttactcttatt
cgtgagagggcgaagcttaagggggagcttgtgcgagctttaggtggtgctttagcctca
tcatctcttcttggagttcctctaggacataattcatcattccttcaagggccagccttt
gctcctcctcgtataagggaggcaatctggtgtggcagcacaaacgccacaactgaagaa
gggaaagaattaaatgatccacgggtgcttactgatgttggtgatgtccctgtccaagag
ataagagattgtggtgtagatgatgacaggttgatgaaaattataagtgagtctgtcaag
ctagtgatggaagaagatccattgcgcccattagttttaggtggtgaccactcaatatca
tttcctgttgtaagggctgtgtctgagaagattgggggtcctgtagatattcttcacctg
gatgcccatcctgacatttatcattcctttgaaggaaacaagtattcacatgcatctccc
tttgcccggatcatggagggtggttatgctcgacggcttttgcaagttggtcttcgatcc
attacaagtgaaggccgtgaacaaggcaagagattcggtgtggagcaatatgaaatgaga
acgttttcaagagatcgacacattttggagaacctgaaactaggggaaggcgtgaagggt
gtatacatttcattagatgtggactgtcttgatcctgcatttgctcctggggtatctcat
attgagccaggaggtctttctttccgcgatgttctcaacatcctccacaacctgcaagcc
gatgttgttgccgctgatgtggttgagttcaatccgcaacgtgacacagtggatgggatg
actgcaatggttgctgccaagctggtaagagaactgactgctaagatgtcaaaaatgaag
aactag

DBGET integrated database retrieval system