KEGG   Vitis vinifera (wine grape): 100248249Help
Entry
100248249         CDS       T01084                                 

Definition
(RefSeq) probable protein S-acyltransferase 14
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
vvi  Vitis vinifera (wine grape)
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvi04131]
    100248249
Enzymes [BR:vvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     100248249
Membrane trafficking [BR:vvi04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    100248249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 100248249
NCBI-ProteinID: XP_002267258
Position
Un
AA seq 294 aa AA seqDB search
MAWNVFKFCTALRGLGSVMIFIVLGVVGVTYYALVVVNYGPSLFHGDLDLLIALAVLLLF
HSLLVMLLWSYFSVVSTDPGGVPLNWKPMVDEEKGDVDPLLGSEHTGVGLGVDQENMVAN
PASEAVRFCRKCNLFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGAKNYKYFLLFLFYTF
LETTLVTLSLLPHFIAFFSDGEIPGTPGTIAATFLTFVLNLAFALSVLGFLIMHISLVAA
NTTTIEAFEKKRTSTWRYDIGRKKNFEQVTVFFNMLHYCQFVPISFNLFAINFM
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggaacgtcttcaaattctgtacggcactgcgtggcctcggctctgtcatgatc
ttcatagtcctgggcgtcgtgggtgtcacctattatgctctcgttgttgtcaattacggc
ccttctctctttcatggtgaccttgatttgctcattgctcttgcagtcttgttgctgttt
cattctttgttggtgatgctgctgtggagctacttttctgttgtttccacggatccgggt
ggtgttccactgaattggaagcccatggtggacgaggagaaaggagatgttgatccattg
ctgggttcagaacatactggtgtaggcttaggtgtggaccaggaaaatatggttgctaac
ccagcaagtgaagcagtccggttttgtaggaagtgcaacctatttaaaccaccccggtgc
catcactgctctgtttgcgggagatgcatattgaaaatggaccatcactgtgtgtgggtt
gtcaattgcgttggggcaaagaactacaagtatttccttcttttcttgttttacacattt
cttgagacaactcttgtcactttatcgctattgcctcatttcatagcattcttttctgat
ggagagatacctggaacaccaggcaccattgcagccacttttcttacttttgttttgaat
ttggcatttgcgttgagtgtactgggctttctgatcatgcacatatcattggtagcagcc
aataccacaaccattgaggcatttgagaagaagcgcacctctacatggcgttatgacatt
ggtcgaaagaaaaactttgaacaggttacagttttttttaacatgttacattattgccaa
tttgttcccatttcatttaatttgtttgctataaattttatgtga

DBGET integrated database retrieval system