KEGG   Vitis vinifera (wine grape): 100248519Help
Entry
100248519         CDS       T01084                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00010  Glycolysis / Gluconeogenesis
vvi00562  Inositol phosphate metabolism
vvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100248519
   00562 Inositol phosphate metabolism
    100248519
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100248519
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100248519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 100248519
NCBI-ProteinID: XP_002273619
Position
13
AA seq 496 aa AA seqDB search
MPMAIVTFLVLLLSVFEHSAFGEPFDVRQHLSTASRYDAVKDIAGHAFLPSNVPDGCSPI
HLNLVARHGTRSPTKKRMRELDNLATHLESLLKDVKEQNLSLKKVPSWLWGWTSPWKGKL
KGGELTDAGEDELYHLGIRIRERFPDLFSEEYHPDVFTIKATQVPRASASAVAFGMGLFS
GRGNLGPGHQRAFAVISESRASDILLRFFDCCKNYKDFRKSQEPAVDKLKEPIIDEINAA
LKKRYKLNFTRQDTSSLWFLCKQEASLLDITDQACGLFSPSEVALLEWTDDLELFILKGY
GKSLNYKMGVPLLKDVFDSMEQAIEAKEGNYAPGSYEKARLRFAHAETVVPFSCLLGLFL
EQSEFKQMQREKPLQYPPKSPQKRNFRGSMVAPFAGNNMLVLYSCPPNSSSKYFVQVLHN
EHPIPMPGCDNSDLCPFEVFKERIVTPHMNHEYEALCSVKSEKGEPKPAPSKLSQLFHWL
FPQGNEDDAQSLKCDL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcctatggcgatcgttacttttctggtactgttgctgtctgtctttgagcattcggcc
tttggcgaaccgttcgacgtccggcaacatctatcgactgcttcaagatatgatgcagtg
aaagatattgctggccatgcctttctgccgtccaatgttccagatgggtgtagtcccatc
cacttaaatcttgtggcaaggcatgggactcgttctcctactaagaaacggatgagagag
ctagacaatttggccacacatttagaatcacttctaaaagatgtaaaagagcagaatttg
tctttgaagaaagttccttcatggttatggggatggacatctccttggaagggaaagcta
aagggtggggaacttactgatgctggagaagatgaactgtatcatctaggaatcagaatt
cgagaaagatttccagatttgtttagtgaggaataccacccagatgtatttacgataaaa
gcaacccaggtccctcgggcatcagctagtgctgtggcatttggaatgggactgttcagt
gggagaggaaatcttggaccagggcatcagcgagcttttgctgttattagtgagagccgt
gcaagtgatatattgctcaggttttttgattgttgtaaaaactacaaggattttaggaaa
agtcaggagcctgctgttgataagcttaaagaacctatcattgatgagattaatgctgca
ttaaagaagcgttacaagctgaattttaccagacaggatacttcttctctgtggttttta
tgcaaacaggaagcatccctactggacataactgatcaagcttgtggtcttttcagccct
tcagaggttgctttgttggagtggacagatgatttagagctatttatattgaagggttat
ggtaaatctctaaactacaaaatgggagtgccattgcttaaagatgtttttgattccatg
gagcaagctattgaagctaaggaaggaaactatgctcccggcagttacgaaaaggcaaga
cttcggtttgcccatgcagagactgtagttccattctcatgcctgcttgggctctttctg
gaacagtctgaatttaaacaaatgcaaagagaaaaaccgttgcaataccctcctaagtcc
ccccagaaaagaaatttcaggggcagcatggtggcaccttttgcagggaataacatgttg
gttctatacagttgtcctcccaactcttcaagcaaatattttgtgcaagtactgcacaac
gaacaccccattccaatgccgggttgtgacaactctgatctgtgtccgttcgaagttttc
aaggaaagaatagtcactcctcacatgaaccacgagtacgaagccctctgcagtgtaaag
tcagaaaaaggggagccgaagccagcaccaagtaagttatcacaacttttccattggctc
ttcccacaggggaatgaagatgatgcccagtctctcaaatgtgacttataa

DBGET integrated database retrieval system