KEGG   Vitis vinifera (wine grape): 100248675Help
Entry
100248675         CDS       T01084                                 

Definition
(RefSeq) probable nucleolar protein 5-2
  KO
K14565  nucleolar protein 58
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    100248675
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:vvi03009]
    100248675
Ribosome biogenesis [BR:vvi03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    100248675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT ECM1
Motif
Other DBs
NCBI-GeneID: 100248675
NCBI-ProteinID: XP_002273273
UniProt: F6HTW5
Position
14
AA seq 573 aa AA seqDB search
MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSSSESARQVVKLKAFSKFENTTEALSAA
TLLIDSKPSKGLRKFLRVHCDGETLAVADSKLGNAIKEKLQIECVHNNAVMELMRGVRSQ
LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR
VREWYGWHFPELAKIVQDNILYAKAVKLMGNRTNAAKLDFSEILPEEVETELKEAAMISM
GTEVSDLDLMNIKELCDQVLSLSEYRAQLYDYLKSRMNTIAPNLTALVGELVGARLIAHG
GSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLIYHASLIGQAAPKLKGKISRSL
AAKTALAIRYDALGDGQDNSMGLENRAKLEARLRNLEGRELGHSAGSAKGKPKIEVYDKD
RKKGSGALITAAKTYNPAADSVLGRIEDSAAREEEEMIPKKRKKEVEPSQPEDTLVVVEE
KKEKKEKKKKKKADVEDASLPNDVVGDAEPESEEVVKKEKKKKKKHSAENDELQNEGEAG
EKKKKKRKHAEPEEETKEPSKKKEKKKKKKSED
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtgttgtttgaaactccggcgggttttgccctattcaaggtattggatgaaggg
aagctctccaaagtcgaggacttgtggaaggagttctccagttcagaatcggccagacag
gtggtgaagctgaaagctttttcaaagtttgagaacacaacagaggctctatcagcagct
accttgctgattgatagcaaacccagcaaaggtctgcgcaagttcttgcgtgttcattgt
gatggagaaacattagctgtggctgattctaaacttggaaatgcgattaaggagaaactg
caaattgaatgtgttcacaacaatgctgttatggagctaatgaggggagtgagaagtcag
ttgactgaactcatatctggtcttgctgttcaagatttggctccaatgagcctaggttta
tctcacagcctatctagatacaagctaaaattcagtcctgacaaggttgacaccatgatc
atccaagctattggcttgctggatgatcttgataaagaacttaacacatatgctatgagg
gttcgagaatggtacggttggcattttccggagcttgcaaagattgtgcaagataacatc
ctctacgccaaagcagtgaagctgatgggtaaccgcacaaatgctgcaaaacttgatttc
tctgagatattgccagaagaagttgagacagaattgaaagaggcagccatgatatcaatg
ggaactgaagttagtgacttggatttgatgaatatcaaagagttgtgcgaccaagttttg
tctctttccgagtacagggctcaactgtatgattatttaaaaagcaggatgaacaccatt
gctccaaatttaactgctcttgttggagagcttgttggtgctcggcttattgctcatggg
ggcagcttattaaatcttgcaaaacagcctggaagcacggtccagattcttggtgcagaa
aaggctctgttcagagctctgaagacaaagcacgcaactcccaagtatgggcttatctat
catgcatccttgattggccaggcagccccgaagctcaagggaaaaatttctcgatcactt
gctgccaaaactgcattggcaattcgatatgatgctcttggagatggtcaagataactct
atgggactggagaatcgagccaagcttgaagcacggttaaggaatcttgaaggcagagaa
ttaggtcactctgctgggtcagccaaaggcaaaccaaagatagaagtctatgacaaggat
aggaagaagggctcaggggcattgataactgctgccaagacttacaatccagcggcagac
tctgttcttggaaggatagaagattcagcagccagggaagaggaagaaatgatcccaaaa
aagaggaagaaggaagtagagccatctcaacccgaggacacccttgttgtggttgaagag
aagaaagaaaagaaagaaaagaaaaaaaagaaaaaggccgatgtagaggatgccagcttg
ccaaatgatgtagttggtgatgcagaaccagaaagtgaagaggtggtgaaaaaggaaaag
aagaaaaagaagaagcactcagccgagaatgatgaattgcaaaatgaaggtgaagcagga
gaaaaaaagaagaaaaagagaaagcatgctgaacccgaagaggaaaccaaagagcctagc
aagaagaaagagaaaaagaagaagaagaagagtgaagactga

DBGET integrated database retrieval system