KEGG   Vitis vinifera (wine grape): 100248975Help
Entry
100248975         CDS       T01084                                 

Definition
(RefSeq) Fanconi anemia group D2 protein homolog
  KO
K10891  fanconi anemia group D2 protein
Organism
vvi  Vitis vinifera (wine grape)
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vvi03400]
    100248975
DNA repair and recombination proteins [BR:vvi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     100248975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 FANCI_S2
Motif
Other DBs
NCBI-GeneID: 100248975
NCBI-ProteinID: XP_010657085
Position
12
AA seq 1511 aa AA seqDB search
MVLHHQLSSRKRPAINHPFAPPKIPKPKTTPTPTPTTTTTPTTTNEVDQSQRLQNDVAEA
TAIDKMVSLLADAGCTLFHPSGPPCLPSNPHNFRRHLHRLFSSSSNASIRSAFLSGFSFY
VQSSQNLHRVLLPSNRDGLGPATCESLVRHLLLVPPIQLDLQNMLLEKLPEYFDINPEYF
GRSSSLDEDVARLIVNHFRWLDFLVDSYAFTNKLMQVLSICPLHLKKEIIGSLPEIIGDQ
NNKTVVDSLEKMLQEDSAIIVSVLDSLSNLNLDDQLQEQVVTISLSCIRTIDAEHMPYLL
RFLFLSATPTNVRRIISQIREQLKFVGVSSSSTVQHRKLKGKSTLGNTNASILDALRSSL
RFKNMLCQEILKELKCIERIRDHKVIDIWLLMLIYMNGESLQKSVEKIFKKKIIEGCIHE
AMVDQCIGGNMELVQDYFPSFLSLSEYLLACKEEKARDFGIHMYSILFEEFVDTYSRQEI
LGALVTHVGSGISFEVTSALDTMVLLVSKYAHELVPLSSHINGVLDYLEGFSVENLHKVY
EVFSNLAISARSSANFFGSSIANELLMIVRKQVTSPDLKYKKMGLIGTLKIVSCLVDANI
STCPGPSQQANSAEALELLKTSLDSCKQFPIPLILFYDELVTMLDCRTVQPAIVDWIGKH
VGEFESMFLSDLEGGQLSVKDLHCGLEGELMMNLDGDISPICLNILPLVSSSLQSSSNLQ
ILPANFVLLSTIERLANQGSLGGIDALLGCPLHLPSSKYFSGDGWQSLTGKQKHVVCLSL
YYATNWIRELLNAFCTQVVDGRFACTTQATREETIVKLLKRLRNLLFLESLLNNSLKQYP
LSLPELHLHVEHSGFHPNLVGHVEKKNEHKKTYESFSSNNKRKDRKMSKASKDSGIDGKL
RQPTILDVLKKAGVTTSQGTPNDDSSALSPKCRTSESADQHTYDTNKHIILEVSAVFKVL
ETQRSKFRPLLVDCFSIFTFSTNQDSCCPDPAAELPLHLYLLRDIRYKLDFFSPPSKAFS
ARHLGSPPGLSRVTVSQFLAKIKPLFPTFKKHFNAAVSILKEGNENCEEHWKVQSASAGN
PDIPNLVLSRSSVCTSVFNEILHCFNMMLRLADINLDKPILTGLLEAFQPIKMQDSIFSG
LQPIPLPGTIEYLYCGAYSFVEDILDLACSFSFMLASEALLTLESIVTSILKFNDKLMEG
NDRSTSMGSIEAVLPTLRSRLGTSSRKILMHNWDNENSENGVKRKGEIVQRILQIYLGNS
ESTSDLLHELAFSILPQAQSSKTTEEDDCHGFPTLCPATFNIWYRVLHEENLAILNKLVK
EVVHSEKSRAGVQLGTVEELLIKLQKSANVLVSLVNMCRTQDKVAVHAMAVKYGGKFVDS
FLKVFDFLQIHFQMHNELIIQLVKELQKATRTIQTLCSEAKGLKQTVITSKIPSTKRSME
RFLFRVKALLHTSPSECTFWMGNLKHKDLMGQVVSSQAYMDHQNDNLDENPEEPIAEDQS
TGDASEEDREL
NT seq 4536 nt NT seq  +upstreamnt  +downstreamnt
atggtactccaccaccaactctcttcccggaaacggcccgccatcaaccacccatttgca
ccacccaaaatccctaaacctaaaactacccctacccctacccctaccaccacgaccacc
cccaccaccaccaatgaagtcgaccaatcccagagactccaaaacgatgtcgcagaagcc
acagccatcgacaagatggtgtcactgctggcagacgcaggttgcaccctcttccacccc
tccggcccaccatgtctcccctccaatcctcacaacttccggcgccacctccaccgcctc
ttctcctcctcctccaacgcctctatacgctccgccttcctctccggcttctccttttat
gttcaatcttctcagaatctccacagggttcttttaccttcaaatcgtgatggtttgggt
ccagcaacatgtgagagcctggtccgacatctcttactcgttcctccaatccaattagat
cttcagaacatgcttctcgagaagcttccagaatattttgatataaatccagaatatttt
ggaagatcatcttcacttgatgaggatgtggcccggcttattgttaatcatttccgctgg
cttgattttcttgttgattcttatgcatttaccaataaattgatgcaagtcctatcaatt
tgtcctttacacttgaagaaagagattattggatctttgccagagattattggcgatcaa
aacaacaagaccgtggttgattcacttgaaaaaatgcttcaagaagattctgctatcatt
gtgtctgtgcttgattctctttccaatttgaatttggatgatcagttgcaggagcaggtt
gtcaccatatcattgtcatgcattagaacaattgatgcagagcacatgccatatttactc
cgattcttatttctttctgcaacaccaacaaatgttcgaagaataatctcacagatccga
gagcagttaaaatttgttggggtatcaagttcaagcacagtgcagcaccgtaaacttaag
ggaaagtcaactttgggcaatacaaatgcttcaattcttgatgccttgagatcaagtcta
cgatttaagaatatgctatgtcaggagatcttgaaagaattaaaatgcattgaaagaatt
cgggaccacaaagtgattgacatatggctgcttatgcttatatacatgaatggtgaatcc
ttgcaaaaaagtgttgagaagatattcaaaaagaaaattattgaaggttgtattcatgaa
gctatggttgatcagtgcattggtggaaacatggaattagtacaggattatttcccctca
ttcctctccttgtcggagtacttattggcatgcaaagaagaaaaagcaagggactttggc
attcacatgtattccattctatttgaagaatttgttgatacttattcaagacaggaaatt
ctcggtgcattagttactcatgtgggttctggcattagttttgaagtgacctctgctttg
gacaccatggttctgctcgtctccaagtatgcacatgaattggttccactttcttctcat
ataaatggtgtcttggattacttggagggatttagtgtagaaaatctgcataaagtctat
gaagttttcagcaatctagcaatatcggctcgatctagtgcaaatttttttggatcatcc
attgcaaatgaacttttgatgatagttaggaagcaggtcaccagtccagatttgaagtat
aagaagatggggctaattggaactctgaagatagtttcttgtcttgtggatgctaatatt
tctacctgccctggcccatctcagcaagcaaactctgcggaggctttggaactcttgaaa
acatctttggactcttgcaaacagtttccaataccattgattctgttttatgatgaatta
gtcacaatgttggactgcagaacagttcaacctgcaattgtggattggattggcaaacat
gttggagagtttgaatctatgtttttatctgatcttgaaggtgggcagttgtctgttaaa
gacttgcattgtggtttagaaggagaactaatgatgaacttggatggtgatatatctcca
atttgtctgaacattttgccactggtttcctcatccttgcagtcctcttcgaatttacaa
attcttcctgctaattttgttttactatctacaattgagaggttggcaaatcagggatct
ctaggtggaattgatgcactgcttggctgtcctttacaccttccttcatctaagtacttc
tcaggagatggctggcagtctcttacaggaaaacagaaacatgtcgtgtgcctctccctc
tattatgcaactaactggataagggaattgcttaatgctttctgtacacaagtcgtcgat
ggtagatttgcatgtacaactcaggctacaagagaggaaacaattgtgaagctgttgaaa
cgtttgaggaacctcttatttctggaaagcttgttaaataattccctcaaacaatatcct
ctatctctacctgagctccaccttcatgtggagcattctggatttcatcctaatcttgtg
gggcatgtggaaaagaagaatgagcataagaaaacatatgaaagcttctcatcaaacaac
aaaaggaaagatagaaagatgtcaaaggcatcaaaagattcagggattgatggaaaactc
agacagcctactattcttgatgtgttgaagaaagcaggagtcacaacaagccagggaaca
ccaaatgatgattcgtctgctctatcccctaaatgcaggacatctgaatcagcagatcaa
catacctatgacaccaacaagcacataattttagaagtttctgcagttttcaaggttctg
gaaacacagagatccaagttccggcctctactggttgattgtttttccatttttacattt
tcaacgaatcaagattcctgttgccctgatcctgcagctgagttacccctacatctgtac
cttctacgtgatattcgctacaagttggatttcttcagtcctccaagcaaagcattttca
gcccgacacttgggttccccacctggtctcagtagagtgacagtgagtcaattcttggcc
aaaattaaaccactgtttccaacatttaagaaacattttaatgctgcagtttctattctt
aaagaaggtaatgaaaattgtgaagaacattggaaagttcaatctgcttctgctgggaat
ccagatatacccaatcttgtgctttcaagatcttctgtttgtacctcagtatttaatgaa
atacttcattgcttcaatatgatgttaagacttgctgatattaatctggacaaaccaatc
ctcacaggtcttcttgaagccttccagccaatcaaaatgcaagatagtattttctcaggc
ttacaacctatccctctgcctgggaccatagagtatctatattgtggtgcttattctttt
gtggaagatatcttggacttagcatgttctttctcttttatgctggcttctgaagctcta
cttactcttgaatcaattgtaacatcaattctgaaattcaatgataagttaatggaagga
aatgatagaagtacaagcatgggatctattgaggccgtccttcctactttgcgcagcaga
cttggcacttcttctcgcaaaattctaatgcataattgggataatgaaaattctgagaat
ggtgtgaagagaaaaggagaaatagtgcagaggatactgcaaatatacctggggaatagt
gagtccacttctgatttgttgcatgagcttgctttctctatcttacctcaggcacaatca
tccaaaacaacagaagaagatgattgtcatggcttcccaactctatgtcctgcaacgttt
aatatatggtaccgggtactgcatgaagagaaccttgctattcttaacaagttggttaag
gaagtagttcactcggagaaaagcagagctggtgttcaacttggcactgtagaagaactt
ttgatcaaattacagaagtcagcgaatgtgcttgtatcattagtcaacatgtgcaggact
caggacaaggtagctgtgcatgcaatggctgtcaagtatggtgggaagtttgtggattcc
ttcctcaaagtttttgacttcttacagatccacttccaaatgcacaatgagcttataatc
caactggtgaaagaacttcagaaagcaacaagaacaatacagaccctgtgctctgaagcc
aaaggcttgaaacaaacggttattaccagcaaaattcccagtacaaagagatctatggaa
cgcttcttgttccgagtcaaggctcttctccacacttccccgagtgaatgcactttctgg
atgggcaatctgaaacacaaagatttgatgggtcaggtggtgagctcccaagcatatatg
gaccatcaaaatgacaatcttgatgagaatcctgaagagcctattgccgaggatcaatct
acaggtgatgctagtgaagaggatagagaattgtaa

DBGET integrated database retrieval system