KEGG   Vitis vinifera (wine grape): 100252270Help
Entry
100252270         CDS       T01084                                 

Definition
(RefSeq) glutathione S-transferase zeta class
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00350  Tyrosine metabolism
vvi01100  Metabolic pathways
Module
vvi_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100252270
Enzymes [BR:vvi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     100252270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C
Motif
Other DBs
NCBI-GeneID: 100252270
NCBI-ProteinID: XP_002273077
Position
12
AA seq 216 aa AA seqDB search
MEETQLKLYSYWRSSCSCRVRIALNLKRLKYEYKAVNLVKGEQFSPEFSKLNPLNFVPAL
VDGDIVVADSFAILMYLEEKYPQHPLLPQDLHKRAINYQAANIVSANIQPLQNLVVLKYI
EEKCGSGERLTWVKHHIEKGFAALEKLLKDHAGKYATGDEVFLADLFLAPQIHAALKRFK
MDMTEFPLLLRLNDAYNELPAFQDAMPEKQPDYVPS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggaggagactcagctgaagctgtattcttattggcggagttcctgctcctgtcgtgtt
cgaattgccctcaacttgaaacggctgaaatacgagtacaaagcagtgaacttggtgaaa
ggagagcagttcagtccagagttttcaaagctgaatcctctcaattttgtgccggcacta
gtggatggggacatagtagttgctgattcttttgccattttgatgtatttggaagagaag
tatcctcaacatccattgttgcctcaggatctacataaaagagctatcaattaccaggct
gccaatattgtttctgcaaacatacagccacttcagaatttggttgtactgaaatatatt
gaggaaaagtgtggtagtggtgagaggctcacatgggtcaaacatcatattgaaaaaggc
tttgcagccttggagaagctattaaaagatcatgctggaaaatatgcgactggagatgaa
gttttcctggctgatttgtttctagcaccccagattcatgctgcacttaaacggttcaaa
atggacatgactgaattcccccttttattaaggttgaatgacgcatacaatgaattgcca
gcattccaagatgctatgccagaaaaacagcccgactacgtcccatcatag

DBGET integrated database retrieval system