KEGG   Vitis vinifera (wine grape): 100254058Help
Entry
100254058         CDS       T01084                                 

Definition
(RefSeq) (R)-mandelonitrile lyase-like
  KO
K08248  (R)-mandelonitrile lyase [EC:4.1.2.10]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00460  Cyanoamino acid metabolism
vvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    100254058
Enzymes [BR:vvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.10  (R)-mandelonitrile lyase
     100254058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C NAD_binding_8 Pyr_redox_2 FAD_binding_2 DAO Lycopene_cycl FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 100254058
NCBI-ProteinID: XP_002277531
Position
2
AA seq 548 aa AA seqDB search
MAKPMSSSPSFLALLIVFSLHHLSRGQFPQGPSYSKFVVNATEMPPEDYYDYIVVGGGTA
GCPLAATLSENFRVLVLERGGVPYTNPNLMSQDGFLTSLMEADPYDSPAQTFTSEDGVAN
ARGRVLGGSSAINAGFYSRADEDFYKKSGLKWDLHIVNQSYEWVERAVVFRPELKNWQSA
VRDGLLEAGVDPYRGFILDHAVGTKIGGSTFDSSGRRHTAADLLGYAKATNIRVAVHASV
ERILLAPTSALSGSKQSAIGVVYRDRIGRYHHAMVRENGEVILSAGAIGTPQLLLLSGIG
PRSYLSSWGIPVVHHLPYVGQFLYDNPRNGISIVSPIPLEHSLIQVVGITNLGAYIEAAS
NVIPFASPARSVFIRTPSSPLYLTVATLMEKIIGPLSSGSLQLASTDIKVNPLVRFNYFA
DPLDLERCVSGMRKVGDVLRSRSMEEFKFREWFGGQDFRFVGPALPVNQSNDAQMAEFCH
RTVSTIWHYHGGCIVGKVVDSDHQVLGIDALRVVDGSTFNVSPGTNPQATLMMLGRYIGI
KITKERMR
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacccatgtcgtcttctccttcatttcttgctttactcatcgtttttagcctc
caccacctctctcgaggacagtttccacaaggtccaagctactctaaatttgtagttaat
gctacggagatgccgccggaagattactatgactacatcgtcgtcggcgggggaactgcc
gggtgcccattggcggcgacgctgtcggagaattttcgagtattggttctggaacgtggt
ggtgtgccttacaccaatcccaatctgatgagccaagatggtttcttaacctctctcatg
gaggccgacccctacgactcccctgctcaaacattcacgtccgaagatggcgtagccaac
gccagaggccgggttctcggcggcagtagcgcaatcaacgccggcttctacagcagagct
gacgaagatttctataaaaaatcagggctgaaatgggacctccacattgtcaatcagtcg
tatgagtgggtggagagggcggtggtctttaggccggagctcaagaactggcaatcagca
gttcgggacgggttgttagaggctggtgttgatccatacaggggtttcattcttgatcat
gccgtgggaaccaagattggtggctccacttttgatagttccggcaggcggcacactgcc
gctgaccttcttggctatgccaaagccaccaacatcagagtggcagtccacgccagtgtt
gaaagaatcctccttgcccctacttcagccctgtctgggtcgaagcagtctgcaatcggg
gtggtgtatcgtgatagaatagggcggtaccaccatgcaatggttcgggaaaatggagag
gtgatactgagtgctggggccattgggactcctcagctgctgctcttgagcggcattggg
ccaaggtcgtatctctcttcgtggggaattccggtggtgcatcatttgccttatgtgggg
cagttcctctatgataacccccgaaatggtatttcaattgtttccccaattcccctcgag
cattcattgatacaagtagtgggaataactaatttaggggcttatattgaagcagcttcc
aatgtcataccttttgcatctcctgcccgctctgttttcattcggacaccttcttctccc
ctctatctcactgtggccaccctcatggagaagataattgggccactctcgagtggttct
cttcaactcgcatccacagatatcaaggtgaacccacttgtcaggtttaactattttgct
gatccacttgacttggaacgatgtgtaagtggcatgcgcaaggttggggatgtcttgagg
agtcgttcaatggaggagttcaagttcagggagtggtttgggggtcaagatttcaggttt
gttggacctgcattgcctgttaaccaatccaatgatgctcagatggctgagttctgccat
cgaacagtgagcacgatatggcattatcatggaggctgcattgtgggtaaggtggttgat
agtgatcaccaggtccttggcattgatgctcttagagttgtcgatggttcaactttcaat
gtgtcaccaggcactaatcctcaggctactttaatgatgctcggacggtatattgggata
aaaataaccaaagagcgaatgagatag

DBGET integrated database retrieval system