KEGG   Vitis vinifera (wine grape): 100254909Help
Entry
100254909         CDS       T01084                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00350  Tyrosine metabolism
vvi00360  Phenylalanine metabolism
vvi00380  Tryptophan metabolism
vvi00950  Isoquinoline alkaloid biosynthesis
vvi00965  Betalain biosynthesis
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100254909
   00360 Phenylalanine metabolism
    100254909
   00380 Tryptophan metabolism
    100254909
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    100254909
   00950 Isoquinoline alkaloid biosynthesis
    100254909
   00965 Betalain biosynthesis
    100254909
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvi04147]
    100254909
Enzymes [BR:vvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     100254909
    4.1.1.105  L-tryptophan decarboxylase
     100254909
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100254909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 100254909
NCBI-ProteinID: XP_002280285
UniProt: A0A438IVJ1
Position
10
AA seq 506 aa AA seqDB search
MSLAQSDQERHCMMNPLDHEEFRRQGHMIIDFIANYYRDIEKYPVRSQVEPGYLHKRIPE
NAPYNPEPIETILQDVQNHIVPGLTHWLSPYHFAYYPANASIAASLGEILCTGFNVDGFN
WMASPAATELENIVMDWLGKMLELPESFLFSGNGGGVIQGTTGDAVLCTVIAARDQLLNR
IGRENIVKLVVYGSDQTHCSLHKAAKIAGIHPNNVRSVKTTKSKAFALSPDSLRAAIISD
KEAGLIPLYLCATVGTTSSGAVDPVGPLCDVAEDYGIWVHIDAAYAGSACICPEFRHFID
GVECANSFSFNPHKWLLTNLDCCCLWVKDPSALVNAFSTDSEYLKNTATDSKQVVDYKDW
QVPLTRRFRAIKLWLVLRSYGVVNLRNYLRRHVEMAKHFEGLIAMDKRFEVVVPRNFSLV
CFRISPSARVNGCSADDEESTANELNRKLLKSLNDSGLVCMTHAIVGGIYMIRFSIGQPL
TDYRHIEMAWKVVQEYTDAMLGTYLK
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtcactggctcagtctgatcaagaacggcattgcatgatgaacccactagaccatgaa
gagttcagaaggcaaggtcatatgatcatcgacttcattgctaattattatcgagacatt
gagaaatatcctgtccgaagccaagttgaaccaggttatctccataaacgtattccagaa
aatgctccatataacccggaacccattgaaacaattctccaggatgtgcagaaccacatt
gttcctggtttaactcactggctgagcccctaccacttcgcttactatcctgcaaacgca
agcattgcagcgtcactcggtgaaattctctgcactggttttaatgttgatgggttcaat
tggatggcctcgcctgctgcaacggagctggagaacatagtgatggattggcttggaaag
atgctcgagcttccagagtctttccttttctcgggaaatggtgggggtgtcatccaggga
accactggtgatgccgtcttgtgcacagtcattgccgctagagatcaattgctgaaccga
atcggcagagagaacatagtgaagctagtcgtgtatgggtccgatcaaacccattgttca
ctccataaagcagctaaaatcgctggaatccaccccaacaacgttcgatcggtaaagaca
acaaagtcaaaggcatttgcactatcaccagattcactccgagcagcgataatatccgat
aaggaagcagggctaataccactttatctctgtgccactgttggaaccacttcatctggt
gctgttgatccagttggcccactctgtgatgttgcggaagattatggcatatgggtccat
atcgatgctgcatacgccggaagtgcttgcatatgccctgagttccggcatttcattgat
ggcgttgagtgtgcaaactcattcagttttaatccacataaatggctcttgacgaaccta
gattgttgctgcctttgggtgaaggatccgagtgcccttgtcaatgctttctcaactgat
tctgagtacttgaagaacaccgctactgattctaaacaagtggtggattacaaggactgg
caagtacctctaacccgaagatttcgcgcaattaaactctggcttgtgcttcggagctat
ggtgtcgtcaacctcagaaactacctgaggcgtcacgttgaaatggccaagcattttgaa
ggtcttatagccatggacaagagatttgaagtggttgtgccaagaaactttagtctggtc
tgctttaggatttcaccatctgcaagagttaatggctgtagtgctgatgatgaggagagt
actgcgaatgaactcaaccgcaagctgctcaagtccctaaacgattcgggacttgtgtgc
atgactcatgccattgttgggggaatatacatgattcgcttctccatcggccaacccctt
actgattatcggcacatagagatggcttggaaggtggtgcaggaatacacagatgccatg
cttggcacctacctaaaataa

DBGET integrated database retrieval system