KEGG   Vitis vinifera (wine grape): 100255373Help
Entry
100255373         CDS       T01084                                 

Definition
(RefSeq) phosphoinositide phospholipase C 4
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00562  Inositol phosphate metabolism
vvi01100  Metabolic pathways
vvi04070  Phosphatidylinositol signaling system
vvi04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100255373
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100255373
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100255373
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100255373
Membrane trafficking [BR:vvi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100255373
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100255373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_like EFhand_Ca_insen
Motif
Other DBs
NCBI-GeneID: 100255373
NCBI-ProteinID: XP_002278527
UniProt: F6GUR2
Position
6
AA seq 588 aa AA seqDB search
MGSYRVCMCFRRKFRVVEAEPPEDVKEAFKKYAEGGTHMTAEQLRRFLLESQSDGSVTLS
DAERIVEQVLQKRHHIAKFTRHNLTLDDFHHFLFSTDLNAPIGSQVHQDMNAPLSHYFIY
TGHNSYLTGNQLSSDCSDVPVIKALKRGVRVIELDIWPDSTKADVHVLHGRTLTTPVELI
KCLRSIKEHAFSASPYPVIITLEDHLTPDLQAKVAQMVTQTFQDILFYPKSECLQEFPSP
EELKYRIIISTKPPKEYLEAKGSEDKENNIQKGKDSDDDVWGEEPSNITADHENNDKSDS
EGSEVDEDGEENNDCRPIGAPAYKHLISIHAGKPKGGFKDALKVEPNKVRRLSLSEQALE
KATASHGTDVVRFTQKNFLRIYPKGTRFNSSNYKPLIGWTHGAQMVAFNMQGYGRYLWLM
HGMFRANGGCGYVKKPDFLMNVGPNNQVFNPRVKLPVKKTLKVKVYMGDGWHLDFKQTHF
DLYSPPDFYARVGIAGVPGDEVMKKTKTKEDKWTPVWNEEFQFPLTVPELALLRVEVHEY
DLSEKDDFAGQTCLPISELKPGIRAVPLFNRKGEMFCSARLLMRFEFV
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggggagttaccgggtgtgtatgtgtttccgccggaagttcagggtggtggaggcggag
cccccggaggacgtgaaggaggccttcaagaagtatgcggaagggggaacccacatgacg
gcggagcagttgcggcggttcttgttggagtctcagagcgacggctctgtgactctgtct
gatgctgagcggatcgtggagcaggtgctgcagaagaggcatcatattgctaagtttacg
aggcacaatcttaccctcgatgattttcaccattttctcttttctactgatctcaatgcc
cccattggatctcaggttcaccaagatatgaatgctcccctgtcccattatttcatatat
acgggccacaactcatacctaactggcaaccaactcagcagtgattgcagcgatgtcccg
gtcataaaggcattgaagagaggtgtaagagtaattgagcttgatatatggccagattcc
acgaaagcagatgtgcatgttctccatggaaggaccctgacaactcctgtggaattgatt
aaatgcttgagatccattaaagaacatgctttttcggcatccccttaccctgtcatcata
actcttgaagaccacctgactccagaccttcaggctaaagtagctcagatggtcactcaa
acatttcaagatattctgttttatcctaagtcagaatgtctgcaagaattcccttcgcct
gaggaactgaagtatcggattattatttcaaccaaacctccgaaagagtatcttgaagct
aaaggatctgaggataaggaaaataacatacagaaaggaaaggattctgatgatgatgta
tggggggaggagccatcaaacattacagctgatcatgagaacaatgataagagtgatagc
gaagggagtgaagtcgatgaagatggtgaagaaaacaatgactgtcgcccaattggagca
cctgcatacaagcatctaatttccattcatgctggaaaacccaagggtgggtttaaggat
gcactaaaggtggaacctaataaagttagacgccttagtttgagtgaacaagcacttgaa
aaggctacagcatctcatgggacagatgtcgtgagattcacccagaagaattttctgagg
atataccctaagggtactcggtttaactcctcaaattacaagccattaattggttggact
catggagctcaaatggttgcatttaatatgcagggatatggtagatatctttggttaatg
cacgggatgttcagagccaatgggggttgcggctatgtgaagaagcctgactttctgatg
aatgtgggtccaaacaatcaagtgttcaatcctagagtaaaattgccagtgaagaaaact
ttgaaggtgaaagtgtacatgggagatggatggcatttggattttaaacaaacacacttt
gatttatattctccgccagacttctatgccagggttggcatagcaggagtacctggcgat
gaggtaatgaagaaaactaagacaaaagaggataaatggactcctgtttggaatgaagaa
tttcagttcccattgacggttcctgagctggctttgcttagagttgaagtgcatgagtat
gatttgtccgagaaggatgattttgcaggccaaacttgtttgccaatttctgaactgaag
ccagggatccgtgcagtccccctctttaatcgcaaaggagagatgttctgctctgctagg
cttctcatgcgctttgaatttgtctga

DBGET integrated database retrieval system