KEGG   Vitis vinifera (wine grape): 100255626Help
Entry
100255626         CDS       T01084                                 

Definition
(RefSeq) putative pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00790  Folate biosynthesis
vvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100255626
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvi04147]
    100255626
Enzymes [BR:vvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     100255626
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100255626
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 100255626
NCBI-ProteinID: XP_002273897
UniProt: D7TK00
Position
10
AA seq 176 aa AA seqDB search
MARILQFPLTSLFRSLSGAHGRSSIQVTKILHDRVEVSSNRKSLNGFRTFCTGEDLSIKK
CVPCNSNDIRPMTEQAANELIPKVPGWNLVNETDTLKLNRSWKVKSFTKGLELFQAVADV
AEAEGHHPDLHLVGWNNVKIEIWTHAVGGLTENDFILAAKINGLDLQRLLRRKAAT
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggctaggatattacagttcccattaacatcgctctttcgaagcctatctggagcccat
ggacgctccagtattcaagtaactaagatacttcacgaccgtgtggaagtgtcatcaaat
aggaagtcacttaatggatttagaactttttgcaccggcgaagatttgtcaatcaagaag
tgtgtcccatgcaactcaaatgacatacggcccatgactgaacaagcagcaaatgaacta
attcccaaggtaccagggtggaatttggtgaatgagactgatacattgaagctaaatagg
tcatggaaagtaaagagttttactaaaggtttggagctatttcaggcagtagctgatgtt
gcggaagctgaaggtcaccatccggatcttcatctcgttggctggaataacgttaaaatt
gagatatggactcatgcagttggtggactgacggaaaatgacttcatacttgctgctaag
atcaatgggcttgacctgcagcgccttctgagacgaaaagctgctacttga

DBGET integrated database retrieval system