KEGG   Vitis vinifera (wine grape): 100258596Help
Entry
100258596         CDS       T01084                                 

Definition
(RefSeq) valencene synthase
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    100258596
Enzymes [BR:vvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     100258596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth RAP
Motif
Other DBs
NCBI-GeneID: 100258596
NCBI-ProteinID: XP_002277351
Position
18
AA seq 559 aa AA seqDB search
MSVLSNMSSHSLAQNYKPEVKRPMVNFHPGIRGNPFINYTPDDEITRAYNQKQVEDLKDE
VRREQLAAAGKPSQQLNFIDAIQRLGVAYHFEEEIEEALRHICDDHHYSDDKYDDLYNVS
LRFRLLRQQGYNISCDVFNKFKDKNGSFRESLIGDVQGMLGLYEAAHLRVQEEDILDEAL
AFTTTHLKSLVKHLDHPLAVQVTQALHRPIRKGLERLEARPYIFIYQDEASHSKALLKLA
KLDFNLLQSLYKKELSHITRWWEDLDFSSSLPFVRDRVVETYLWIVVACFEPQYSYARRI
QTKLLVLITVIDDIYDAYGTLEELELFTEAIERWDNNGIEKLPEYMKPCYLAVLDAYKEI
EEKENEERSYCVHYAKEAMKNSVRAYFNEAKWLHGEYVPTVEEYMGVALVSCDVPMFTII
SFVGMGFIATKEAFDWVLNGPKIVRACSTIIRLMDDMASHKFEQERGHIASSVECYMKQY
SVSEQLAYHELNKQVEKAWKDINQEFLRPTAIPMPLLTRVLNFARTGDFMYKGREDIFTN
VGEVMKDNVASLFIDPVPM
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtccttagcaacatgtcttctcattccttagcccaaaattataaaccggaggta
aagcggccgatggtaaactttcacccaggcattcgaggcaatcctttcatcaactacact
cctgatgatgagataacccgtgcctataaccagaagcaggttgaagacttgaaagacgaa
gtgaggagagagcaactggcagctgctggtaagccttcacagcagctgaacttcatagat
gcaattcaaagactcggggtggcataccactttgaagaagaaatagaagaagcattaaga
cacatctgtgatgaccaccattacagtgatgataaatatgatgatctgtataatgtttct
ctccgatttcgtcttctaagacaacaagggtacaatatttcatgcgatgtattcaacaag
ttcaaagataaaaatggtagctttagggaatctctgattggagatgtgcaaggcatgcta
ggcttgtatgaagctgcacatctcagggttcaggaagaggatatactagatgaagcactt
gctttcaccaccactcacctcaagtctttggtaaaacatttagaccatcctcttgcagta
caagtaacccaagccctacaccggcccattaggaaaggtttggagaggctggaggcaagg
ccttacatattcatctaccaagatgaagcttcacatagtaaagctttattgaaacttgcc
aagttagatttcaacctactgcagtcattgtataagaaagagttaagccacatcaccagg
tggtgggaagatttagatttctcttcgagtttaccttttgtccgggatagagtggtggaa
acctacctttggattgtcgtggcatgttttgagccccaatactcgtatgctagaagaata
cagaccaaattgcttgttctaataacagtgatagatgatatctatgatgcgtatgggact
cttgaagaacttgagctcttcacagaggcaattgagaggtgggacaataatggtatagaa
aagcttccagaatacatgaagccgtgttacctggctgtcttagatgcctacaaagaaatt
gaggagaaggagaatgaagaaagatcatattgtgttcactatgcaaaagaggcaatgaaa
aactctgttcgagcttacttcaatgaagccaaatggctccatggagaatatgtaccaacg
gtagaagaatacatgggcgttgcactagtaagctgtgatgtccccatgttcacaatcatc
tcttttgttggcatgggattcatagcaacaaaggaggcctttgattgggtattaaacggc
ccaaagatcgtcagagcttgctccacaattattaggctcatggatgacatggcttcacac
aagtttgagcaagagagagggcatattgcctctagtgttgaatgttacatgaagcaatat
agtgtctcagagcaacttgcataccacgagcttaacaagcaggttgagaaagcatggaaa
gatataaaccaggagttcctcagacctactgctattccaatgcctctccttacacgtgtt
ctcaattttgcacgcactggagatttcatgtacaaaggtcgtgaggatatattcacgaat
gttggagaagtgatgaaagataatgttgcttcattgttcattgaccctgtgccaatgtaa

DBGET integrated database retrieval system