KEGG   Vitis vinifera (wine grape): 100259293Help
Entry
100259293         CDS       T01084                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
vvi  Vitis vinifera (wine grape)
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvi04131]
    100259293
Membrane trafficking [BR:vvi04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100259293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 100259293
NCBI-ProteinID: XP_010656059
UniProt: D7TC76
Position
11
AA seq 1847 aa AA seqDB search
MENLSPSGHRFRRIPRQSIAANLKLDPLLDENLEQWPHLNELVQCYRTDWVKDENKYGHY
ESISPVLFQNQIFEGPDTDIETEMQLASARQIKAEDTTDDDIPSTSGRQFSDATFSDSSH
SKVLKHFGQSPLPAYEPAFDWENERSMIFGQRTPETPTTQYGSGLKISVKVLSLSFQAGL
VEPFYGTICLYNRERRDKLSEDFFFRILPTEMQDACITYEPRGIFYLDVPSASVCLLIQL
EKPATEEGGVTSSVYSRKEPVHLTERERQKLQVWSRIMPYRESFAWAIVPLFDNSMSAAS
GGSTSPSSPLAPSVSGSSSHEGVSEPTAKITLDGKLGYSSRSSVIVEISNLNKVKESYTE
DSLQDPKRKVHKPVKGVLRLEIEKLQAGHADLENISESGSVTNDSIDPGDRIADSTFTKC
PSNGSDGPQNSNSKWNFFDGKEIPRNGSNAFGYSDFNADDFQAFDFRSTTRNEPFLQLFH
CLYVYPLTVSLSRKRNLFIRIELRKDDADARRQPLEAMCMREPGVSLQKWAHTQVAVGAR
VACYHDEIKLFLPAIWTPMHHLLFTFFHVDLQTKLEAPKPVVVGYASLPLSTHAQLRSEI
SLPIMRELVPHYLQDSGKERLDYLEDGKNIFRLRLRLCSSLYPINERIRDFFLEYDRHTL
RTSPPWGSELLEAINSLKNVDSTALLQFLHPILNMLLHLIGNGGETLQVAAFRAMVNILT
RVQHESVDDAERNRFLVNYVDYAFDDFGGRQPPVYPGLSTVWGSLARSKAKGYRVGPVYD
DVLAMAWFFLELIVKSMALEQTRLFYHSLPLGEDVPPMQLKEGVFRCILQLYDCLLTEVH
ERCKKGLSLAKRLNSSLAFFCYDLLSIIEPRQVFELVSLYLDKFSGVCQSVLHDCKLTFL
QIICDHDLFVEMPGRDPSDRNYLSSVLIQELFLTWDHDDLSQRAKAARILVVLLCKHEFD
SRYQKHEDKLYIAQLYFPLIGQILDEMPVFYNLNAVEKREVVIVILQIVRNLDDASLVKA
WQQSIARTRLFFKLLEECLILFEHRKPADSMLIGCSSRSPSGDGPVSPKYSDRLSPAINN
YLSEASRQEVRPQGTPENGYLWQRVNSHLSSPSQPYSLREALAQAQSSRIGASTQALRES
LHPMLRQKLELWEENLSAAVSLQVLEITEKFSTTAASHSIATDFGKLDCITSVFMSFFLR
NQPLVFWKALFPVFNSVFNLHGATLMSRENDRFLKQVAFHLLRLAVFRNDNIRKRAVIGL
LILVRSSFYYFMQTARLRVMLTITLSELMSDVQVTQMKSDGTLEESGEARRLRKSLEEMA
DEARSPNLLRECGLPENALVVIPEKLSENQWSLSEVKYLSDSLLLALDASLEHALLASVM
TMDRYSAAESFHKLALAFAPVPDLHIMWLLHLCDAHQEMQSWAEAAQCAVAVAGVVMQAL
VGRNDGVWSRDHVTALRKICPMVSREITSEASAAEVEGYGASKLTVDSAVKYLQLANKLF
SQAELHHFCASILELVIPVYKSRRAYGQLAKCHTLLTNIYESILEQESSPIPFTDATYYR
VGFYGEKFGKLDKKEYVYREPRDVRLGDIMEKLSHIYESRMDGNHTLHIIPDSRQVKADD
LQAGVCYLQITAVDPVMEDEDLGSRRERIFSLSTGTIRARVFDRFLFDTPFTKNGKTQGG
LEDQWKRRTVLQTEGSFPALVNRLLVIKSESLEFSPVENAIGMIETRTAALRNELEEPRS
SEGDQLPRLQSLQRILQGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFM
AVCKRAIRVHFRLIGEEDQDFHTQLVNGFQSLTAELSHYIPAILSEL
NT seq 5544 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatttgtcacctagtgggcatcggtttcgaagaatacctcgtcagtccattgct
gctaatctgaagttggacccactgcttgatgaaaatttggagcagtggccgcatctgaat
gaacttgttcaatgctacagaactgattgggtaaaggatgaaaacaaatatggtcattat
gaaagcatcagtccagttttgtttcaaaatcagatatttgaagggcctgatactgatatt
gaaacagaaatgcagcttgccagtgcaaggcaaatcaaggctgaagatactactgatgat
gatattcccagcacctcaggaaggcaattttcagatgctactttctctgattcatcacac
tcaaaagttttaaagcattttggtcaatctcctcttcctgcttatgaaccagcttttgac
tgggaaaatgaaaggtcaatgatatttggtcaaaggactccagaaactccaacaacacag
tatggcagtggattgaagatctctgtgaaagtcctatccttgtcgtttcaagcggggcta
gttgagccattttatggcacgatttgcttgtataatcgggaaagaagagataaattgtca
gaggatttcttttttcgcatattgccaactgaaatgcaggatgcttgcattacttatgaa
cctcgtggcatcttctatttagatgtgccctcagcatcagtttgtctgctgatccagtta
gagaagcctgccacagaagaaggcggggttacttcttcagtttattcgcgtaaagaacca
gtgcatctgactgagagagaaaggcagaaacttcaggtgtggtctcgaatcatgccttac
agggagtcctttgcttgggcaatcgttccattatttgataacagcatgagtgctgcttct
ggtgggtctacttcccccagtagtcctcttgctcctagtgtatcggggtcaagttcccat
gagggtgtttcagagcccactgcaaagatcacattggatgggaaactgggttattcaagc
agaagttctgtcatagttgaaatttcaaacttaaataaagttaaagaaagctacactgag
gactcacttcaggatcctaagcgcaaggttcataaacctgtgaaaggcgttttaaggttg
gaaattgaaaagctccaggctggccatgctgatttggaaaatatttcagaaagtgggagt
gtgaccaatgattccattgaccctggggaccgaattgctgattccactttcacaaaatgc
cccagcaatggttctgatgggcctcagaatagcaattccaagtggaatttctttgatgga
aaagaaattccaagaaatggatcaaatgcatttggatattcagattttaatgctgatgat
ttccaagcttttgacttccgcagtacaacaagaaatgaacctttcttgcagctttttcat
tgtctttatgtatatcctttgactgttagtttaagtcggaaaaggaatttgttcatacgg
attgaactcagaaaggatgatgcagatgctcgcaggcagcctttagaggcaatgtgtatg
agggagccaggtgtctcacttcagaaatgggctcacacacaagttgctgttggggctagg
gtggcctgctaccatgatgagatcaaacttttccttcctgctatttggacaccaatgcat
caccttttattcactttctttcatgttgacctgcaaacaaaacttgaagctccgaagcca
gtggttgtaggatatgcttcacttccactatctacacatgctcagttgcgatctgaaatt
tctttaccaattatgagagagctggttccgcattatcttcaagactctggcaaggagagg
ctggattatttggaagacgggaaaaatatttttagattgcggttaagactatgttcatcc
ttataccctattaatgagcgcattagagatttttttcttgaatatgataggcatactctt
cgaacaagccctccctggggttctgaactacttgaggccattaatagtttgaagaatgtt
gattccactgctttgcttcagtttcttcatccaattttgaatatgcttctccatcttata
ggcaatggtggtgaaaccctccaggttgctgccttcagagccatggttaatattttaacc
cgggtgcaacatgagtctgttgatgatgctgaaagaaatcgttttctggttaactatgtt
gattatgcttttgatgactttgggggtcgtcagccaccggtttatcctggtttgtccact
gtgtggggaagcttagctcgcagtaaggctaaaggctaccgtgtagggccagtgtatgat
gatgtcttggcaatggcttggtttttcctcgagctaattgtcaagtcaatggcattggag
cagactcgtcttttctatcatagccttcccttaggtgaagatgttccaccaatgcaattg
aaagagggtgtattcagatgtatattgcagttatatgattgccttctaactgaagttcat
gagagatgcaaaaagggcttaagcttggccaaacgtttgaacagcagtttggccttcttt
tgttatgatctgttatctattattgagcctcgccaagtttttgaattggtctctttgtac
ttggacaagttttctggggtatgtcagtcagttctgcatgactgcaagcttacatttttg
cagatcatatgtgaccatgatctttttgtggaaatgccgggcagagatccttcagatagg
aactacctttcatctgtcttgatacaggagcttttccttacatgggatcatgatgatttg
tctcagcgagcaaaagcagctagaatcttggtagtcctcctgtgcaagcatgagtttgat
tctcgataccagaagcatgaggataaattatatattgcccagttatattttccacttatt
ggccagattctagatgagatgcctgtcttttacaacctaaatgctgttgaaaagcgtgaa
gtagtaatagttattctgcaaattgtgcgcaatctggatgatgcatcacttgtcaaggct
tggcagcaaagcattgctcgaacaagattatttttcaaactcttggaggaatgcctaatt
ctttttgagcacagaaaacctgcagatagcatgcttattggctgtagttctcgcagccct
tctggggatggacctgtgtccccaaagtactcagatagactctcgcctgctattaacaac
tatctatctgaggcatcacgacaagaagtcagacctcagggaacacctgagaatggttat
ttgtggcagagagtcaattctcatttaagctctcccagccagccatattctttgagagaa
gctcttgcacaggcacaatcttctagaattggtgcttcaacccaagcgctaagagaatcc
ttgcacccaatgttaaggcaaaaactggaactttgggaagagaacttgagtgctgctgtc
agtcttcaggttttggaaataactgagaaattttccacaactgcagcatcccacagcatt
gcgactgactttggaaaacttgattgcatcacatccgtatttatgagcttcttcttgcgt
aatcaacctctcgttttttggaaagctttatttcctgtgttcaacagtgtcttcaatctt
catggagcaacactgatgtcaagggagaatgatcgtttcttaaaacaagtcgccttccat
cttcttcgccttgcagtttttcgaaatgataacatcaggaaaagagctgttattgggctc
ctgatactcgtcaggagctccttctattactttatgcagacagcgaggttaagagtcatg
ttgacaattacgttgtcggagttgatgtctgatgtgcaagtgactcagatgaaatctgat
gggacactggaagagagtggtgaagcacggcgtctgcgaaaatcattggaagaaatggca
gatgaagctaggagtcccaacctattaagggagtgtgggctacctgagaatgctcttgtt
gtaattccagaaaaattgtcagagaaccagtggtccttgtctgaggtgaaatacctctct
gacagtcttcttttggcccttgatgctagccttgaacatgcactgttggcttctgtcatg
actatggatagatattcagcagcagagagcttccacaaacttgcattggcatttgcccct
gtcccagatcttcacataatgtggttactgcatttatgtgatgcacatcaagagatgcaa
tcttgggctgaggctgcacagtgtgcagttgctgttgctggtgttgtgatgcaggctctt
gtgggtagaaatgatggtgtctggagcagagatcacgtgactgctttacgtaaaatttgc
cccatggtcagcagggagattacttctgaggcatctgcagcagaagtagagggatatggt
gcttcaaaactcactgtggactctgccgtgaaatacctacagcttgcaaataagcttttc
tctcaagctgagcttcatcatttctgtgccagcattctggaacttgtaattccagtttat
aaaagcaggagggcatatggacagctggccaaatgccacactttgctaactaacatttat
gaatcaatccttgagcaggaatcaagcccaataccattcactgatgccacctactatagg
gtgggattctatggtgaaaaatttgggaagctggataaaaaggaatatgtataccgagag
cctcgtgatgtacggctgggtgacattatggagaaacttagtcatatatacgagtctagg
atggatggtaatcacactctccacatcattcctgactctagacaagtcaaagcagatgac
ttgcaggctggagtctgctatctgcaaataactgctgttgatccagtcatggaagatgag
gatctgggaagcagaagggagagaattttttctctttccactggaaccattcgtgcacgt
gtatttgatcgtttcttgtttgataccccatttacgaaaaatggcaagacccaagggggt
ttggaagaccaatggaaacggcgaacagttcttcagactgagggctcattcccagcccta
gtgaataggctcttggtgattaaatctgaatctctagaattctcccctgttgagaatgca
attggaatgattgaaactcggacagctgcattacgcaatgagcttgaagagcctcgcagc
tctgaaggggatcaactcccacgcctccaaagcctacagagaatactccaaggcagtgtt
gcagttcaagtgaacagtggagtgctgagtgtgtgcacggcctttctttcgggtgagcct
gcaacaaggctgcgttcccaggagcttcagcaactcattgctgccctccttgaattcatg
gctgtatgcaaacgtgccatccgggtacacttcaggttgattggagaggaagaccaggat
ttccacacacaacttgtgaatgggtttcagtctctcactgcggagctatcccactacatt
cctgccatcctctcagaactctga

DBGET integrated database retrieval system