KEGG   Vitis vinifera (wine grape): 100259551Help
Entry
100259551         CDS       T01084                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi03040  Spliceosome
vvi04141  Protein processing in endoplasmic reticulum
vvi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100259551
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100259551
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100259551
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvi01009]
    100259551
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:vvi03041]
    100259551
   03009 Ribosome biogenesis [BR:vvi03009]
    100259551
   03110 Chaperones and folding catalysts [BR:vvi03110]
    100259551
   04131 Membrane trafficking [BR:vvi04131]
    100259551
   03051 Proteasome [BR:vvi03051]
    100259551
   03029 Mitochondrial biogenesis [BR:vvi03029]
    100259551
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvi04147]
    100259551
Protein phosphatases and associated proteins [BR:vvi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100259551
Spliceosome [BR:vvi03041]
 Complex B
  Other components
   Prp19 complex
    100259551
 Complex C
   Prp19-CDC5 complex
    100259551
Ribosome biogenesis [BR:vvi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100259551
Chaperones and folding catalysts [BR:vvi03110]
 Heat shock proteins
  HSP70 / DNAK
   100259551
Membrane trafficking [BR:vvi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100259551
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100259551
Proteasome [BR:vvi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100259551
Mitochondrial biogenesis [BR:vvi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100259551
Exosome [BR:vvi04147]
 Exosomal proteins
  Proteins found in most exosomes
   100259551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 100259551
NCBI-ProteinID: XP_002263599
UniProt: F6HLD8
Position
8
AA seq 649 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLVGDAAKN
QVAMNPINTVFDAKRLIGRRFSDATVQSDIKLWPFKVVAGPGDKPMIVVNYKGEEKQFAA
EEISSMVLMKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFY
TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNDKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTFSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK
KVDAKNALENYAYNMRNTVKDEKIGAKLPPADKKKIEDAIEQAIQWLDNNQLAEADEFED
KMKELESICNPIIAKMYQGAGGPDMGGGMDEDGPSAGGSGAGPKIEEVD
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggctggaaaaggtgagggtccggcgatcggaatcgatctcggcacgacctactcgtgc
gtgggagtgtggcaacatgatcgtgttgagatcattgcgaacgatcaaggaaacaggacg
acgccgtcttatgttgcgttcactgataccgagaggttggtcggtgatgcagctaagaac
caggtcgccatgaaccccattaacaccgtctttgacgcaaagaggttgattggtagaaga
ttcagtgatgcgactgtccagagtgacatcaagttgtggccattcaaggttgttgctgga
ccgggtgacaagcccatgattgtagttaactacaagggcgaggagaagcagtttgctgca
gaggaaatttcttccatggttctaatgaagatgcgtgagattgctgaggcctacttgggt
tctgctgtgaaaaatgctgtggtcactgtccctgcctatttcaatgattctcagcgtcaa
gctaccaaggatgctggtgtcattgctggtctcaatgtgatgcgtatcatcaatgagccc
actgctgctgccattgcctatggtcttgacaagaaggccaccagtgttggtgagaagaat
gtcttgatctttgatcttggcgggggtacttttgatgtctctcttctcaccattgaggag
ggtatctttgaagtgaaagctacagcaggagacacccaccttggaggtgaagattttgat
aacagaatggtcaaccactttgttcaggagttcaagaggaagcacaagaaggacattagt
ggcaaccccagggctctcaggagattgagaactgcatgcgagagagctaagaggaccctc
tcatccactgcccagaccaccattgaaattgattctttgtatgaaggcgttgatttctac
accaccattacccgtgccagattcgaggagcttaacatggacctcttcaggaaatgtatg
gagcccgttgagaagtgtctaagggatgcaaaaatggacaagagcagtgttcatgacgtt
gtcctagtcggtgggtctaccagaattcccaaagtccagcagcttttacaggacttcttc
aatgggaaggaactttgcaagagcatcaaccctgatgaggctgttgcctatggtgctgcc
gtccaagctgccattttaagtggtgagggcaatgataaggttcaggaccttctgctgctg
gatgttacccctctctcccttgggttggaaactgctggcggtgtcatgactgtgctgatt
cccaggaacactaccattcccacaaagaaagagcaagtcttctccactttctctgacaac
cagcctggtgtattgatccaagtgtatgaaggagagagaacgaggaccagagacaacaac
ttgcttggtaagtttgagctctctggcattcctccagctcccaggggtgttcctcagatc
acagtctgctttgatattgatgccaatggtatcctgaatgtatctgctgaggacaaaacc
actggtcagaagaacaagatcactattaccaatgacaagggaagactgtcgaaggaggag
attgagaagatggtacaagaggctgagaagtataagtcagaggatgaagagcacaagaag
aaggtggatgctaaaaatgctttggaaaattatgcttacaacatgaggaacacagtgaag
gatgagaagattggagccaagctccccccagctgataagaagaagattgaggatgccatt
gagcaagccatccagtggctggataacaaccagctggcggaggcggatgaatttgaggac
aagatgaaggagctggaaagcatctgcaaccccatcatagcaaagatgtaccagggtgct
ggaggacctgacatgggcgggggaatggatgaagatggtccctcagctggcggaagtggt
gctggtcccaagattgaggaagtggattaa

DBGET integrated database retrieval system