KEGG   Vitis vinifera (wine grape): 100259631Help
Entry
100259631         CDS       T01084                                 

Definition
(RefSeq) eukaryotic translation initiation factor
  KO
K03259  translation initiation factor 4E
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi03013  RNA transport
Module
vvi_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100259631
Messenger RNA biogenesis [BR:vvi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100259631
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100259631
Translation factors [BR:vvi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100259631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 100259631
NCBI-ProteinID: XP_002285444
UniProt: F6H8U4
Position
5
AA seq 204 aa AA seqDB search
MASEAAGMESGAAGMESGAAPTEAAKQPHRLERKWTFWFDNQSKPKQGAAWGTSLRKAYT
FETVEEFWCLYDQIFKPSKLPANADFHLFKAGVEPKWEDPECANGGKWTVASSRKGNLDT
MWLETLMALIGEQFDEADEICGVVASVRQRQDKLALWTKTATNEAAQMSIGRKWKEVIDV
TDKITYSFHDDSRRERSVKVRYNV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtgaggcggcagggatggagagcggcgcagcagggatggagagcggcgcagca
ccaacggaggcggccaagcagccacacaggctggagaggaagtggaccttctggttcgat
aaccagtccaagcccaagcaaggcgcggcttgggggacctctcttcgcaaggcttacacc
ttcgaaaccgtcgaagaattttggtgtctgtatgatcagatatttaagcccagcaagttg
ccagccaatgcagatttccatttgttcaaagctggggttgaaccaaaatgggaagatcct
gagtgtgcaaatggaggcaaatggactgttgccagcagccgaaagggtaatcttgatacc
atgtggctagaaacgttgatggccttaattggggagcaatttgatgaggctgatgaaata
tgtggtgtggttgcaagtgtacgtcaaaggcaggataagcttgctctgtggactaagaca
gcaaccaacgaggctgctcagatgagcattggaaggaagtggaaggaggtcattgatgtc
actgataagatcacttacagctttcatgatgattccagaagggaaagatcagtcaaagtt
cgatacaacgtgtga

DBGET integrated database retrieval system