KEGG   Vitis vinifera (wine grape): 100261154Help
Entry
100261154         CDS       T01084                                 

Definition
(RefSeq) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00052  Galactose metabolism
vvi00561  Glycerolipid metabolism
vvi00600  Sphingolipid metabolism
vvi00603  Glycosphingolipid biosynthesis - globo and isoglobo series
vvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100261154
  Lipid metabolism
   00561 Glycerolipid metabolism
    100261154
   00600 Sphingolipid metabolism
    100261154
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100261154
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100261154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase Glyco_hydro_97
Motif
Other DBs
NCBI-GeneID: 100261154
NCBI-ProteinID: XP_002268711
UniProt: D7TXW6
Position
10
AA seq 409 aa AA seqDB search
MGESGLHACGLFVLTVMMVVGVGAICGGAPGLLNSESTETTSWRNLLANGLACTPQMGWN
SWNHFGCKIDENLIKETADAMVSSGLAALGYHYVNLDDCWGEKNRDSDGNLVAKHSTFPS
GIKALADYVHKKGLKLGIYSDAGTQTCSKTMPGSLGHEEKDAKTFASWEVDYLKYDNCEN
TGIRPQERYIKMSKALLNSGRSIFFSLCEWGQEDPATWAKDVGNSWRTTGDIEDNWDSMT
SRADENDKWAAHAGPGGWNDPDMLEVGNGGMRKEEYQSHFSIWALAKAPLLIGCDVRSMD
NSTFELLSNKEVIAVNQDELGVQGRKVKKDGNLEVWAGPLSDNKVAVVLWNRGSSQANMT
AHWSDIGLSPSAVVDARDLWAHSTQSSVQGQLWAQVDSHACKMYILTPK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagtccggcttgcatgcgtgtgggttgtttgtgctgactgtgatgatggtggtg
ggggtgggggcgatttgtgggggagccccagggcttctgaattctgagtcaacagagacc
accagttggaggaatcttttggccaatggccttgcctgcactcctcagatgggatggaac
agctggaaccattttggttgcaagattgatgagaatttgattaaggaaacagctgatgca
atggtgtcaagtggccttgctgcattaggataccattatgttaatttagatgactgttgg
ggcgaaaagaatagagattctgacgggaatttggttgctaagcattcaacatttccttca
ggcatcaaggctctagcagattacgttcacaagaaagggttaaagcttggaatttattca
gatgcaggtactcaaacttgcagtaagaccatgcctggttcactaggccatgaagaaaaa
gatgcaaaaacctttgcctcatgggaagtcgattacttaaaatatgataactgtgaaaac
accggtataaggcctcaggaaaggtacattaagatgagtaaggctttactgaattcagga
agatccatatttttctccttatgtgaatggggacaagaagatcctgctacttgggctaag
gatgtaggaaatagttggaggacaacgggagacattgaagacaactgggatagcatgaca
tctcgggcagatgagaatgacaaatgggcagcgcatgctggccctggtggatggaatgat
cctgacatgcttgaagtaggaaatggtggcatgaggaaagaggagtaccagtctcacttc
agcatatgggcattagctaaagccccattgttgattggctgcgatgttcgatcaatggat
aattcaacctttgaattgcttagcaataaggaggttattgctgtcaatcaagatgaactt
ggtgttcaagggagaaaggttaagaaagacgggaatcttgaggtatgggcgggtcctctc
tctgataacaaggtggctgtagtcctttggaacagaggatcatcgcaagcaaatatgaca
gctcattggtcagatataggcctcagtccctcagctgttgttgatgctcgagacttatgg
gctcattcaactcaatcatcggttcaaggacaactttgggcccaagtggattctcatgct
tgtaaaatgtatatcctcacacccaagtag

DBGET integrated database retrieval system