KEGG   Vitis vinifera (wine grape): 100261494Help
Entry
100261494         CDS       T01084                                 

Definition
(RefSeq) probable succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00020  Citrate cycle (TCA cycle)
vvi00640  Propanoate metabolism
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
vvi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100261494
   00640 Propanoate metabolism
    100261494
Enzymes [BR:vvi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     100261494
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     100261494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 100261494
NCBI-ProteinID: XP_002268479
Position
17
AA seq 340 aa AA seqDB search
MLTKMARRAAAQQLIDSIASKLSSATASSAQTRGFAAAAHPPPAVFVDKNTRVICQGITG
KNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANTSVIYVPPPFA
AAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQTKTRLIGPNCPGIIKPGECKIGI
MPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTSVGIGGDPFNGTNFVDCIKKFLV
DPQTEGIVLIGEIGGTAEEDAAQLIKESKTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGK
GTAQDKIKTLREAGVTVVESPAKMGVAMLEAFKQKGLIPA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgttgacgaagatggctcgccgagccgccgcccagcagctgatcgactcgatcgcgtcg
aagctcagctccgccaccgcttcttcggctcagactcggggttttgcggcggctgcgcat
cctccgccggcggtgttcgtggacaagaacactagggtgatttgccaaggcatcacaggc
aagaacggcacgttccacactgagcaagccatcgaatatggcaccaaaatggtaggtggt
gtaacaccaaagaagggtgggacagaacacttgggacttcctgttttcaacactgttgca
gaggcaaaggctgaaacaaaggctaatacatctgtaatttacgtgcccccaccttttgct
gctgcagctattatggaggcaatggaagctgagttggatcttgttgtatgcatcacagag
ggcatccctcagcatgacatggtaaaggtgaaggctgctctgaacaggcaaacaaaaact
cggctgattgggccaaactgtcctggaattatcaagcctggagaatgtaaaattgggatc
atgcctgggtacattcacaaaccaggccgtgtaggaattgtttcccgatctggtaccttg
acatatgaagcggttttccaaacaaccgcagtcggccttggacagtccaccagtgtaggc
atagggggggatccttttaatgggacaaacttcgttgattgcattaagaagttcctagtt
gatcctcagacagaaggtattgttcttataggagagattggtggtactgctgaagaggat
gctgctcagttaataaaggaaagcaagactgagaagcctattgttgcatttattgctggc
ctaactgctccccctggtcgtcgtatgggtcatgctggagccattgtatcaggtgggaag
ggcacagcccaagacaaaatcaagaccctcagggaagctggtgttacagtggtagaatct
cctgcaaaaatgggtgttgccatgcttgaagccttcaagcaaaagggtctcattccggcc
taa

DBGET integrated database retrieval system