KEGG   Vitis vinifera (wine grape): 100263168Help
Entry
100263168         CDS       T01084                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00052  Galactose metabolism
vvi00500  Starch and sucrose metabolism
vvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100263168
   00500 Starch and sucrose metabolism
    100263168
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     100263168
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 100263168
NCBI-ProteinID: XP_010654109
Position
8
AA seq 572 aa AA seqDB search
MKGGSRLLWFLFSLCCYCVIINNNGVEGSHKIHHEYQCVPDTKVRQVHRTGYHFQPPRNW
INDPNGPMYYNGIYHLFYQYNPKGAVWGNIVWAHSVSRNLIDWEALEPAIYPSKPFDING
CWSGSATILPGNKPAILYTGIDTQQRQVQNIAFPANLSDPYLRKWVKPDSNPLVVPDVGM
NASTFRDPTTAWRVNGHWRMLVGARKKHRGIVYLYRSRDFMTWIKSKHPLHSAQNTGMWE
CPDFFPVSLYSERGLDTSVTGKNVRHVLKVSLDRTRYEYYTIGRYYPEIDRYIPGNTSAD
GWSGLRYDYGNFYASKTFFDAEQKRRILWGWANESDTADNDTAKGWAGIQTIPRTLWLDK
GKKQLLQWPIEELNTLRGQKIQVRNQELKIGENVEITGITAAQADVEVTFSLPSLDKAEE
FDPSWVNAQDLCGMKGSTVQGGVGPFGLLTLASEHLEEYTPVFFRIFKAKGKHVVLMCSD
AKSSSLRTELYKPSFAGFVDVDLKDGMLSLRSLIDHSVVESFGAGGKTCITSRVYPTLAV
SKKAHLYAFNNGTEAVTIKKLNAWTMHRPQMN
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcggttcaaggcttctctggtttttgttctctctttgttgttactgtgtaata
ataaacaacaatggcgttgaagggtctcataagattcatcatgagtatcagtgtgtgcct
gacactaaggttaggcaagttcatagaactggataccactttcaaccccctaggaactgg
ataaacgatccaaatggacccatgtactacaatggaatctaccaccttttctaccagtac
aatcccaaaggtgcagtttggggtaacatcgtgtgggctcactcagtatcaaggaatctg
atagactgggaggcgcttgagccagccatctatccttcaaagccgtttgacataaacgga
tgttggtctggttcagccaccatcttgcctggtaacaagcctgcaattctctacactgga
atcgacacacaacaaaggcaagtccagaacattgcatttccagccaacctctcggatcca
tacctaaggaaatgggtgaaacccgacagcaacccactagtggttcctgatgttggcatg
aatgcaagcacattccgtgacccaacaactgcttggcgggtgaatgggcattggaggatg
ttggtgggtgccagaaagaagcatagagggatagtctatttgtataggagtagagatttc
atgacatggataaaatcaaaacatcctcttcattctgcccagaataccggaatgtgggaa
tgtcctgatttttttcctgtttctttgtatagtgaaagggggttagacacatcagtaacg
ggtaaaaatgttagacatgttttgaaggtgagccttgaccgaactagatatgagtactat
acaattggaagatattatccggaaatagataggtatataccgggcaacacctctgctgat
ggttggagtgggttgaggtatgattatggcaatttttatgcttcgaaaacgttctttgat
gccgagcagaaacggaggattttgtggggttgggctaatgagtcagatacagcagacaat
gatactgcaaaaggatgggctggaattcagacaattccaaggaccctatggcttgacaag
ggtaaaaaacaattgttacaatggcccattgaagaactaaatacactaagagggcaaaag
attcaggtgaggaatcaagagctcaagattggggaaaatgttgaaatcacaggaattaca
gccgcacaggccgatgttgaagttacattctctttgccgagcttggacaaggctgaagaa
ttcgatcctagctgggttaacgcacaagatctctgcggcatgaagggttcaactgttcaa
ggtggggttggaccctttggactgttgacattggcttcagaacaccttgaagagtacact
cctgtcttcttcagaatcttcaaggccaaaggcaagcatgtagtccttatgtgctctgat
gcgaaaagttcctcgttacggacagaactatacaaaccatcattcgcaggttttgtggat
gtagatttaaaagatgggatgctctcccttagaagtttgatcgaccattctgtagtggaa
agtttcggggctggaggaaaaacatgcatcacatctagggtttatcctactctagcagtc
tcgaagaaggctcatctatatgcattcaacaatggaacagaggctgtcaccattaagaag
ctgaatgcatggactatgcatcgtcctcaaatgaactaa

DBGET integrated database retrieval system