KEGG   Vitis vinifera (wine grape): 100266527Help
Entry
100266527         CDS       T01084                                 

Definition
(RefSeq) putative pectinesterase 63
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00040  Pentose and glucuronate interconversions
vvi01100  Metabolic pathways
Module
vvi_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100266527
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     100266527
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-GeneID: 100266527
NCBI-ProteinID: XP_002277202
UniProt: D7U732
Position
16
AA seq 369 aa AA seqDB search
MATTMTSIAFFLLLLLLSLSAVLADNDNAQIPSDKSQLAPWFRNSIQKYKLRRTTLDPAL
VEAEDSVKIIKVSKSGGGNFNTVMAAVNSVPAGNTRRVIIWIGGGEYEEKIKIDRDKPFI
TFYGSPEDMPKLSFDGTAAEFGTVDSATLIVESDYFMAVNIIVINSSPRPDGKRKGAQAV
ALRVSGDKAAFYNCRLIGFQDTLCDDRGRHFFHGCYVEGTVDYIFGSGKSLYLSTELHTK
GDGGFSVITAQARNLESEDNGYSFVHCTLSGTGGNTFLGRAWMSRPKVVFSYTFMSPVVS
PLGWSNNIHPERESLVFYGEYKCMGPGADTSKRSKFTKELDDDGATPFITLNYIDASTWL
LPPPGLALR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggctacaaccatgacttccattgctttcttcctcctcctcctcctcctctcattgtcg
gctgtacttgccgacaatgataatgcacaaatccctagcgataaaagtcaactagctcca
tggttcagaaatagcatccagaagtacaagctccggaggacgacgctggatccagcccta
gtggaggcggaggacagcgtaaaaatcatcaaggtgagtaaaagcggtggaggaaacttc
aatacggtgatggcggcagtcaatagtgttccagctggtaatactcggcgcgtgattata
tggattggaggcggagaatatgaagagaaaatcaagatcgatagggataagccctttata
acattctacggatcaccggaggacatgccaaagctgtcatttgatgggacggcagccgag
ttcgggacagtggacagcgcgacgctcatagtggagtcggattacttcatggcggtgaac
ataattgtcattaactcgtccccaaggccggacgggaaaaggaagggagcccaggcggtg
gcactgagggtgtcaggcgataaggccgcgttttataactgcaggctgatcggttttcag
gacaccctatgtgatgataggggcaggcattttttccatggatgctacgttgaaggcact
gtggactacatatttggaagtggaaagtctctgtatttgagcactgagctacataccaag
ggagacggcgggttttcagtgatcacagcgcaggcaaggaaccttgaatcggaggacaat
ggatactcattcgtccactgcaccttgtcaggtactggcggcaacactttcttagggcgg
gcatggatgagtagaccgaaggtggtgttttcatacaccttcatgagccctgttgtcagt
cctttagggtggtccaataacatccaccctgaacgggaatcattggttttctatggagaa
tacaagtgtatgggaccaggggcagacacatctaaacgatccaaattcaccaaggaacta
gacgatgatggagccacacccttcatcaccctcaactacattgatgcttcaacatggttg
ctgcctcccccaggtcttgcactccgttga

DBGET integrated database retrieval system