KEGG   Vitis vinifera (wine grape): 100267975
Entry
100267975         CDS       T01084                                 

Definition
(RefSeq) U5 small nuclear ribonucleoprotein 40 kDa protein
  KO
K12857  Prp8 binding protein
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100267975
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:vvi03041]
    100267975
Spliceosome [BR:vvi03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    100267975
 Complex C
   U5 SnRNP specific factors
    100267975
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Nup160 Frtz Nbas_N Gmad1
Other DBs
NCBI-GeneID: 100267975
NCBI-ProteinID: XP_002277631
UniProt: A0A438GR81 F6HB26
Position
5
AA seq 344 aa
MQGFPSENALSVVGPRPGMELSAVPCTGPRAPGANGKQRTSSLESPIMLLAGHQSAIYTM
KFNPTGTVIASGSHEREIFLWYVHGDCKNFMVLKGHKNAILDLQWTTDGTQIISASPDKT
LRAWDVETGKQIKKMAEHSSFVNSCCPSRRGPPLVVSGSDDGTAKLWDMRQRGAIQTFPD
KYQITAVSFSDASDKIFTGGIDNDVKVWDLRRNEVTMTLQGHQDMITGMQLSPDGSYLLT
NGMDCKLCIWDMRPYAPQNRCVKILEGHQHNFEKNLLKCSWSPDGSKVTAGSSDRMVYIW
DTTSRRILYKLPGHTGSVNECVFHPSEPIVGSCSSDKQIYLGEI
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgcaaggtttcccaagtgaaaatgctttgtctgttgttggtcctaggccaggaatggaa
ttgtctgctgttccatgtactgggcctcgagcaccaggtgcaaatggaaaacagcggaca
tcgagtttagaatcaccaatcatgttgttggcaggccatcaaagtgctatatacacaatg
aaattcaatccaacgggtacagtcattgcatctgggtctcatgaaagagaaattttccta
tggtatgttcatggtgattgcaaaaatttcatggttttgaaagggcacaagaatgcaatt
ttggatcttcagtggactactgatggaacccagataatatcagccagccctgacaagact
ctcagggcatgggatgtagaaacagggaaacaaataaaaaagatggctgaacactcctct
tttgtgaattcatgttgtccttcccgtaggggtcctcctcttgttgtcagtggatctgat
gatggcactgccaaactttgggatatgcgtcaaaggggtgccatccagacatttcctgac
aaataccaaatcacagctgtcagtttctctgatgcatctgataagatcttcacaggtggg
atagacaatgatgttaaagtatgggatctgagaagaaatgaggttaccatgactcttcaa
ggccatcaggatatgataacaggtatgcagttgagtccggatggctcctatcttcttaca
aatggcatggactgcaaactttgcatatgggatatgcgcccatatgctccacaaaatcgt
tgtgtgaagatattggaagggcaccaacacaactttgaaaagaacttgttgaaatgtagt
tggtctccagatggaagcaaagtcacagctggtagttctgatcggatggtgtatatttgg
gatacaacctctcgacgcatcttgtataagcttcctggtcacactggatctgtcaacgaa
tgtgtcttccatcccagtgaacctattgttggatcttgcagtagcgataaacagatttat
cttggggagatctaa

DBGET integrated database retrieval system