KEGG   Vitis vinifera (wine grape): 100268058Help
Entry
100268058         CDS       T01084                                 

Definition
(RefSeq) photosynthetic NDH subunit of lumenal location 4, chloroplastic
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
vvi  Vitis vinifera (wine grape)
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100268058
Enzymes [BR:vvi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100268058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 100268058
NCBI-ProteinID: XP_002281281
UniProt: D7SW18
Position
7
AA seq 206 aa AA seqDB search
MAISALTVATVKPQTLQTHHPKPSLSFKPIANCISSTKRPVLDVGIGLLAASVVALSPLE
ATATRIEYYATVGEPNCELNFAKSGLGYCDVAVGSGEEAPFGELINVHYTARFADGTVFD
SSYKRARPLTMRIGAGKLIKGLDQGILGGEGVPPMLVGGKRKLRIPPALAYGPEPAGCFS
GDCNIPANATLLYDINFVGIYSGNAK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctctgcactaactgtagcaactgtcaaaccccaaacccttcaaacccaccat
cctaaaccctctctctccttcaaacccatcgctaattgcatttcttcaacaaagagacca
gtattggatgtgggtattgggcttttggcagcttcagtggtggctttgtctccattggag
gcaactgccacaagaatcgagtactacgccactgtaggagagcccaattgtgagctcaac
tttgcaaagtccgggctgggttactgtgatgttgcagtgggatctggtgaggaggctcct
tttggtgagcttatcaatgttcactacactgcaagatttgctgacgggacagtctttgat
agcagctacaaacgtgccagacctctcactatgcgaattggtgctggaaagttgattaag
ggactggatcagggaattttagggggtgaaggagtacctccaatgttagtaggtggaaag
cggaagcttcggattcctccagcgttagcatatgggccagaacctgcaggctgcttttct
ggtgactgcaatatacctgccaacgctactcttctttatgatattaattttgttggcatc
tattcgggaaatgcgaagtga

DBGET integrated database retrieval system