KEGG   Vitis vinifera (wine grape): 104878767Help
Entry
104878767         CDS       T01084                                 

Definition
(RefSeq) heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00900  Terpenoid backbone biosynthesis
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
Module
vvi_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    104878767
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:vvi01006]
    104878767
Enzymes [BR:vvi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     104878767
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     104878767
    2.5.1.29  geranylgeranyl diphosphate synthase
     104878767
Prenyltransferases [BR:vvi01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   104878767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 104878767
NCBI-ProteinID: XP_010647702
Position
3
AA seq 261 aa AA seqDB search
MAFTTALSLPSAARLHHRLPNRSSLSLPRTIRCSSPSISVSPSKSMQFDLRSYWTTLISE
INTKLEEAIPVKYPQQIYEAMRYSVLAKGGKRAPPVMCVAVCELFGGDRLAAFPTACALE
MVRPKQTLISLAHVSCHAFLVLILTLVFHVFACESAFYFSFSVIILGEAERYGRAVGMLY
QVVDDMLKAKTKSEEDEEKKKKGKSYVDVYGMEKAMEVAEELRAKAKRELSGFDKYGDSV
VPLYSFVDFAAERGFTIDTSV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcacaaccgctctatcgctgccctccgctgcccgcctccaccaccgccttccg
aaccgatcttctctgagcctaccacgcacaattcgatgctcttctccttcaatttcagtc
tcaccgtcaaaatcaatgcagttcgatctccgttcctactggaccaccctgatttcagag
atcaacaccaagctcgaggaagccattccggtgaagtatccgcaacagatctacgaagcc
atgcgctactccgtgctagcaaaaggcgggaagcgagctcccccggtgatgtgcgtcgcc
gtctgtgagcttttcggcggcgaccgccttgctgcctttccgaccgcctgtgccctagaa
atggtacggccaaaacaaaccctaatctcactcgctcacgtcagttgtcacgcttttctc
gttttgattttgactcttgtgtttcacgtttttgcctgcgaatcagctttctacttttct
ttttctgtgataatattgggggaagcagaaagatacggccgagctgtcgggatgttgtac
caggtggtggacgatatgctgaaagcgaagacgaagagtgaggaagacgaagagaagaaa
aagaaagggaagagctatgtggacgtgtacggtatggagaaggccatggaagtggcggag
gagcttcgagccaaggcgaagagagagttgagtggattcgacaagtatggcgacagcgtc
gttccgctttacagctttgtggacttcgccgcggaaagaggctttaccatcgatacttct
gtctga

DBGET integrated database retrieval system