KEGG   Vitis vinifera (wine grape): 104882073Help
Entry
104882073         CDS       T01084                                 

Definition
(RefSeq) separase-like
  KO
K02365  separase [EC:3.4.22.49]
Organism
vvi  Vitis vinifera (wine grape)
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:vvi01002]
    104882073
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vvi03036]
    104882073
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     104882073
Peptidases [BR:vvi01002]
 Cysteine Peptidases
  Family C50: separase family
   104882073
Chromosome and associated proteins [BR:vvi03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    104882073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 104882073
NCBI-ProteinID: XP_010662303
UniProt: A0A438CXU3
Position
16
AA seq 236 aa AA seqDB search
MLPWENIPVLRTQEVYRMPSIGSISAILDRSHHHQEQAGMNAAAFPLIDPLDAFYLLNPS
GDLSSSQAAFEKWFRDQNIEGKAGIAPTVEELAGALKSHDLFIYIGLGSGAQYIPRHEIQ
KLENCAATLLMGCSSGSLSLNGQYTPQGTHLSYLSAGTPVRVANLWEVTDKDIDRFGKAM
LDAWLRERSSPSVACAQCRLVPELKSMSITRGKGDAKKKIPRKKVSKACSSVVCED
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcttccatgggagaacataccagtgctacgaacacaggaggtttatcgcatgccttca
attggcagcatctctgccatacttgacagaagccaccaccatcaagagcaggctggaatg
aatgctgctgcctttccgttgattgatcccttggatgcattttatttgttgaatcctagt
ggtgatctcagcagctcacaagctgcatttgaaaaatggtttagagatcaaaacatagag
ggtaaagctggaattgcacccacagtcgaagaattggctggagctttgaaaagtcacgac
ctctttatatatattggccttggaagtggggcacagtatattcccaggcatgagattcag
aaactggaaaattgtgctgctactctcctaatgggatgcagtagtggatcattgtctcta
aatgggcaatacactccacaaggtactcatctttcctatctatcagctggtacccctgtt
agagttgccaatctatgggaagtgacagacaaggatattgaccgatttggtaaggccatg
cttgatgcttggttgagagaaagatcatctccttctgtggcttgtgcccagtgccgtttg
gttcctgaattgaagtccatgagcataactcgtggtaaaggagatgctaagaagaaaatc
ccaaggaagaaagtatctaaagcttgtagtagtgttgtatgtgaagattag

DBGET integrated database retrieval system