KEGG   Vibrio vulnificus 93U204: VV93_v1c01460Help
Entry
VV93_v1c01460     CDS       T03294                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
vvl  Vibrio vulnificus 93U204
Pathway
vvl00561  Glycerolipid metabolism
vvl00640  Propanoate metabolism
vvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    VV93_v1c01460
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    VV93_v1c01460
Enzymes [BR:vvl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     VV93_v1c01460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AIL69246
UniProt: A0A087JRG3
Position
I:159755..160843
Genome map
AA seq 362 aa AA seqDB search
MLTTTIFPGRYVQGKDARKQLGVELNRFGKKGLMICDSFVYDTLFSEFEPYLETVEVEVI
RFASECCDEEITRLTAMLKNFEGEFVVGLGGGKTIDTAKATSYEARVPVAIVPTLAASDA
PCSALSVIYTQEGEFKRYLFLPQNPNLVLVDTQIIAKAPVRFLIAGIGDALATWFEAESC
QQSFASNMTGYMGSLSAYALARLCYDTLLEYGVIAKTSNEQGVVTPALERVVEANTLLSG
LGFESGGLAASHAIHNGLTVLEPTHVFLHGEKVAFGLLSSLFLTDKPAQTIATVYDFCEK
VGLPTTLSQIGLENVSDEDLLAVAEASCAEGETIHNEPRTVTPDMVFAAMKAANVEGLRR
KS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgttaacaacaactatatttccaggtcgttatgttcaaggtaaagatgctcgaaaacaa
cttggagtagaactcaatcgttttggaaaaaaaggtctaatgatctgtgactcatttgtt
tatgatacattattttctgagtttgaaccttatcttgagaccgttgaagttgaagtgatc
cggtttgctagtgaatgttgtgacgaagaaataacacgtctgacagccatgttgaaaaat
tttgagggtgaatttgtggttggattaggtggaggaaaaaccattgatacagcaaaagca
acctcgtatgaagcgagagtccctgtggcaattgtgccgactttggcagcgagcgatgca
ccatgcagtgcactatccgttatttacactcaagaaggagagtttaagcgttatcttttc
ctgcctcaaaatccgaatcttgtcttggtcgacacacaaattattgccaaggcacctgtt
cgattccttatagctgggatcggtgatgcgctagcaacatggtttgaagcagaatcatgc
cagcaaagttttgcctcgaatatgacaggttatatgggttcattgtcagcatatgcgtta
gcacgtttgtgttacgacactttgcttgaatacggcgtaatagctaaaacatcgaatgaa
caaggtgtggttactccagcgctcgaacgtgttgtggaagcaaatacgttgcttagtgga
ttaggtttcgaaagtggtggtcttgctgcttctcatgcgattcataatggtttaacagta
ttggagccaacacatgtgtttttgcatggtgaaaaagtcgcatttggtttgctttcttct
ctattccttactgataaaccagcacagaccatcgcaactgtttatgacttctgcgaaaaa
gttggcttgccaacgactctgtctcaaatcggtttagaaaatgtatccgatgaagattta
ttggcagtggctgaagcttcatgtgcagaaggtgagaccatccacaacgaacctcgaact
gtaactccagatatggtgtttgcagcaatgaaagcggcaaatgtagaagggttacgtcgc
aagagctaa

DBGET integrated database retrieval system