KEGG   Vibrio vulnificus 93U204: VV93_v1c01920Help
Entry
VV93_v1c01920     CDS       T03294                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
vvl  Vibrio vulnificus 93U204
Pathway
vvl00010  Glycolysis / Gluconeogenesis
vvl00020  Citrate cycle (TCA cycle)
vvl00620  Pyruvate metabolism
vvl01100  Metabolic pathways
vvl01110  Biosynthesis of secondary metabolites
vvl01120  Microbial metabolism in diverse environments
vvl01130  Biosynthesis of antibiotics
vvl01200  Carbon metabolism
Module
vvl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VV93_v1c01920
   00020 Citrate cycle (TCA cycle)
    VV93_v1c01920
   00620 Pyruvate metabolism
    VV93_v1c01920
Enzymes [BR:vvl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     VV93_v1c01920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_16 AAA_25
Motif
Other DBs
NCBI-ProteinID: AIL69291
UniProt: A0A2S3R694
Position
I:complement(216144..217772)
Genome map
AA seq 542 aa AA seqDB search
MTVMEHTKAASIDLTKHGLRNVKEVVRNPSYEMLFAEETRADLEGYEKGVVTELGAVAVD
TGIFTGRSPKDKYIVKDATTEEHMWWTTPAVPNDNKPITQEVWNDLKQLVTNQLSGKRVF
VIDGYCGANPDTRLSIRVITEVAWQAHFVKNMFIRPTEEELASFEPDFVVMNGAKCTNQK
WKEHGLNSENFTVFNLTERMQLIGGTWYGGEMKKGMFAMMNYFLPLKGIASMHCSANMGK
EGDVAIFFGLSGTGKTTLSTDPKRALIGDDEHGWDDDGVFNFEGGCYAKTIKLSKEAEPD
IYNAIRRDALLENVTVRNDGSINFDDGSKTENTRVSYPIHHIENIVKPVSKGGHANKVIF
LSADAFGVLPPVSKLTPEQTKYHFLSGFTAKLAGTERGITEPTPTFSACFGAAFLTLHPT
KYAEVLVKRMEEAGAEAYLVNTGWNGSGKRISIQDTRGIIDAILDGSIEEAPTKHVPIFN
LEVPTSLPGVDPTILDPRDTYVDPLQWESKAQDLAQRFINNFAKYTDNAEGQSLVAAGPQ
LD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttatggaacatacaaaggctgcatcaattgatctaaccaagcatggtcttcgc
aacgtaaaagaggttgtgcgcaacccaagttacgaaatgctgtttgcagaagagactcga
gctgatctcgaaggctacgaaaaaggcgtagtgacagagctcggcgcggtggctgtagac
acaggcatcttcactggccgctcaccaaaagacaaatacattgtgaaagatgcgacaacc
gaagaacatatgtggtggacaacaccagccgtcccgaacgataacaagccaatcacacaa
gaagtgtggaatgacctaaaacaactggtcactaaccagctttctggcaagcgcgttttt
gtgattgatggttattgtggtgccaaccctgatacccgtcttagcattcgagtcatcacc
gaagtggcgtggcaagcgcatttcgttaagaacatgttcatccgcccaaccgaagaagaa
ttggccagctttgagcctgatttcgtggtgatgaacggtgcaaaatgcaccaaccaaaag
tggaaagagcacggtctgaactctgaaaacttcacggtgtttaacctaactgagcgcatg
cagttgatcggcggtacttggtacggcggtgagatgaagaaaggcatgttcgcgatgatg
aactacttcctgcctcttaaaggcattgcgtcgatgcactgttctgccaacatgggcaaa
gaaggtgatgtggcgatcttcttcggtctatctggtacgggtaaaacaacgctgtcgacc
gatccaaaacgcgcgctgattggcgatgacgagcacggctgggatgacgacggtgtgttt
aacttcgaaggtggttgttacgcgaaaaccatcaagctgtcgaaagaagctgagcctgat
atttacaatgccatccgccgcgatgcactgcttgaaaacgtaactgttcgcaatgacggc
tcgatcaactttgatgatggttcgaaaaccgagaacactcgcgtttcttacccaatccat
cacattgaaaacatcgttaagccagtatcaaaaggcggtcatgccaacaaagtgatcttc
ctttctgccgatgcgtttggcgtgttgcctccggtgtctaaactgaccccagaacaaact
aagtatcacttcctatctggctttactgcgaagttggctggtactgagcgtggtattact
gaaccaacaccaactttctctgcgtgttttggtgccgcgttcctgacgcttcacccaacc
aagtacgctgaagtactggtaaaacgtatggaagaagcaggggcagaagcctacctcgtc
aataccggttggaacggtagcggcaagcgtatctcaatccaagatacgcgcggtattatc
gatgcgatccttgatggttctattgaagaagcgccaaccaaacacgtgcctatcttcaat
ctagaagtaccaacatcacttcctggtgtggatccaaccatccttgatccacgtgacact
tacgttgacccgctacagtgggaaagcaaagcgcaagatcttgctcaacgctttatcaac
aacttcgctaagtacaccgacaacgcggaaggtcaatcacttgtggctgcaggcccacaa
ctcgattag

DBGET integrated database retrieval system