KEGG   Vibrio vulnificus 93U204: VV93_v1c04440Help
Entry
VV93_v1c04440     CDS       T03294                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
vvl  Vibrio vulnificus 93U204
Brite
KEGG Orthology (KO) [BR:vvl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    VV93_v1c04440 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AIL69541
UniProt: A0A1V8N0N3
Position
I:complement(461584..461964)
Genome map
AA seq 126 aa AA seqDB search
MDVSQPRIQIQVHTKYVEEQSNPELARYIFAYIITIKNHSSESVQLLSRRWLITDANGKQ
ISVEGDGVVGQQPFIDAGDEYTYSSGTALDTPVGVMQGQYIMHDAQGKEFVVEIEPFRLA
VPNILN
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggacgtatctcaaccccgtatccaaattcaagttcacaccaaatacgtcgaagaacaa
tccaatcctgaacttgctcgctatatcttcgcttacatcattaccattaaaaaccacagt
tcagagagcgtgcaactgcttagtcgacgctggttgatcaccgatgccaatggcaaacag
atctctgtggaaggcgatggcgtcgtcggccaacaaccgtttatcgatgctggtgatgag
tacacttacagcagtggcaccgcattagataccccagttggcgtcatgcaaggtcaatac
atcatgcacgacgctcaaggcaaagaatttgtcgtcgaaatcgagcctttccgcctcgcg
gttcccaacattcttaactga

DBGET integrated database retrieval system