KEGG   Vibrio vulnificus 93U204: VV93_v1c28070Help
Entry
VV93_v1c28070     CDS       T03294                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
vvl  Vibrio vulnificus 93U204
Pathway
vvl00564  Glycerophospholipid metabolism
vvl01100  Metabolic pathways
vvl01110  Biosynthesis of secondary metabolites
Module
vvl_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:vvl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    VV93_v1c28070 (psd)
Enzymes [BR:vvl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     VV93_v1c28070 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AIL71879
UniProt: A0A1V8MU23
Position
I:3098184..3099041
Genome map
AA seq 285 aa AA seqDB search
MDKIKVGLQYWIPQHGLTRLVGKLASAKAGSLTTAIIRWFIKQYNVNMDEAKHADPKHYK
TFNEFFVRELKEGARPIAEGDAIITHPADACVSQFGPITNGQLIQAKGHDFSAQELLGGD
AALAEEFKDGSFATLYLSPRDYHRVHMPCDGTLRQMIYVPGDLFSVNPLTAENVPNLFAR
NERVVCIFDTEFGPMAQVLVGATIVGSIEQVWAGTITPPRGNTVYKWDYPASGNHAVILK
KGEEMGRFKLGSTVINLFAKDAIRFDESMANGQPTVMGTPYAHQQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggataagattaaagttggactgcagtactggatcccacaacatggcctgactcgccta
gtgggtaaattggcttccgccaaagcaggcagcctgaccacagcgatcattcgctggttt
atcaagcagtacaacgtcaatatggatgaagcgaaacacgccgatcctaaacactacaag
acgttcaatgagttctttgtgcgtgagctaaaagaaggcgcacgtccaattgctgaaggt
gatgcgatcattacccacccagcggatgcttgtgtcagccagtttggccctattaccaac
ggccaattgattcaagcgaaagggcatgacttctccgctcaagagctgttaggcggtgat
gctgctcttgctgaagaatttaaagacggtagcttcgcgacgttgtatctgtcacctcgt
gattaccaccgtgtacacatgccatgcgatggtactctgcgccaaatgatttacgttcct
ggtgatcttttctcggtgaatcctctgacagcagagaatgtacccaacctatttgctcgc
aatgagcgcgtggtgtgtatctttgatactgagtttggtcctatggctcaagtgcttgtt
ggtgcgaccattgttggtagtattgaacaagtatgggcgggtaccattaccccacctcgt
ggcaatacggtatacaaatgggattatcctgcttctggtaaccatgcggttatcttgaag
aagggcgaagaaatgggtcgcttcaaactcggatcaaccgtcattaacctttttgccaaa
gacgcgattcgttttgatgagtcgatggccaatggccaaccaacggtgatgggcacccca
tacgcccaccagcaataa

DBGET integrated database retrieval system