KEGG   Vibrio vulnificus 93U204: VV93_v1c39850Help
Entry
VV93_v1c39850     CDS       T03294                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vvl  Vibrio vulnificus 93U204
Pathway
vvl00071  Fatty acid degradation
vvl00072  Synthesis and degradation of ketone bodies
vvl00280  Valine, leucine and isoleucine degradation
vvl00310  Lysine degradation
vvl00362  Benzoate degradation
vvl00380  Tryptophan metabolism
vvl00620  Pyruvate metabolism
vvl00630  Glyoxylate and dicarboxylate metabolism
vvl00640  Propanoate metabolism
vvl00650  Butanoate metabolism
vvl00900  Terpenoid backbone biosynthesis
vvl01100  Metabolic pathways
vvl01110  Biosynthesis of secondary metabolites
vvl01120  Microbial metabolism in diverse environments
vvl01130  Biosynthesis of antibiotics
vvl01200  Carbon metabolism
vvl01212  Fatty acid metabolism
vvl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vvl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VV93_v1c39850
   00630 Glyoxylate and dicarboxylate metabolism
    VV93_v1c39850
   00640 Propanoate metabolism
    VV93_v1c39850
   00650 Butanoate metabolism
    VV93_v1c39850
  Lipid metabolism
   00071 Fatty acid degradation
    VV93_v1c39850
   00072 Synthesis and degradation of ketone bodies
    VV93_v1c39850
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VV93_v1c39850
   00310 Lysine degradation
    VV93_v1c39850
   00380 Tryptophan metabolism
    VV93_v1c39850
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VV93_v1c39850
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VV93_v1c39850
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VV93_v1c39850
Enzymes [BR:vvl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VV93_v1c39850
Exosome [BR:vvl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VV93_v1c39850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIL73041
UniProt: A0A1W6MAU2
Position
II:complement(1146364..1147581)
Genome map
AA seq 405 aa AA seqDB search
MAKSIWIVAAKRTPIGRFQGALAALSAPQLGAAAIHAAMDAVSLSAQQVDEVYMGCVLPA
GCGQAPARQAALKAELGYSTPCTTVNKVCGSGMKAVMLAYDQLKAGDKCCMIAGGMESMT
NAPYLLKESRSGMRMGHKTTFDHMFLDGLQDAYEGHLMGVYAQQIADKLNYTREQMDTWA
IQSAQRATQAQHEAQFKEEITPIFLEGRSSMTLDHDEHPTTIQLDKIPKLKPAFADNGTV
TAANSSAIADGAAALILADGDWAEKQGLTPLAIIRGHASHARLPAEFTVAPVYAIEQLLS
QLDWGIDEVDLWEINEAFAVVTQIAIQQLGLAADKVNIKGGACALGHPIGASGARILVTL
IHSLRQLQALGTNGDAKCRRSVKGVAALCIGGGEATAIGIEIPVF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatcaatttggatagtggcagcaaaacgtaccccgatagggcgattccaaggg
gcgcttgccgcgctgagtgcaccgcaattaggcgctgccgcgattcatgcggcgatggat
gccgtttcgttgtccgcgcaacaagtggatgaagtgtatatgggctgtgtgttgcccgca
gggtgtggtcaagcccccgcacggcaagcggcactgaaagccgaattgggttattccacg
ccttgtaccacagtcaataaagtgtgtggctctgggatgaaagcggtgatgttggcctat
gatcagctcaaagcgggtgataagtgctgcatgattgcagggggaatggagagcatgacc
aatgccccatatctattgaaagagtcgcgcagcggcatgcgaatgggccacaaaaccacc
ttcgatcatatgtttcttgatggattgcaagatgcctatgagggccatttgatgggcgtt
tatgcgcagcaaatcgctgacaaactcaattacacccgagagcaaatggacacttgggcc
attcaatcggcgcagcgtgcgactcaggcacagcacgaagcgcagttcaaagaggaaatc
accccgatttttctcgaaggacgcagcagcatgacgctggatcatgatgagcatccaacc
accattcagctcgacaaaattcccaaactgaaacccgcgtttgccgataacggtacggtg
accgccgccaattccagtgcgattgcggatggcgcagcagcactgatattggccgatggt
gattgggccgaaaaacaaggcttaacaccgctggcgatcattcgtggccacgcaagccat
gctcgcttgcccgccgagtttaccgtcgcgcccgtttatgcgattgagcaactgctcagc
cagctcgattggggaatcgacgaggtggatttgtgggagatcaacgaagcgtttgccgtc
gtgacacaaattgctattcagcagctcggcttagccgcggataaagtgaacatcaaaggg
ggggcctgtgcgttaggccaccctattggcgccagtggtgcccgaattttagtcactttg
attcacagcttgcgtcaactacaagcgttgggcaccaatggcgacgctaagtgccgtcgc
agcgtcaaaggtgtggctgcactgtgcattggtggtggtgaagcgaccgccattggtatc
gaaatccccgtattttga

DBGET integrated database retrieval system