KEGG   Vibrio vulnificus MO6-24/O: VVMO6_00533Help
Entry
VVMO6_00533       CDS       T01415                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm00010  Glycolysis / Gluconeogenesis
vvm00020  Citrate cycle (TCA cycle)
vvm00620  Pyruvate metabolism
vvm01100  Metabolic pathways
vvm01110  Biosynthesis of secondary metabolites
vvm01120  Microbial metabolism in diverse environments
vvm01130  Biosynthesis of antibiotics
vvm01200  Carbon metabolism
Module
vvm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VVMO6_00533
   00020 Citrate cycle (TCA cycle)
    VVMO6_00533
   00620 Pyruvate metabolism
    VVMO6_00533
Enzymes [BR:vvm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VVMO6_00533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV85555
Position
I:592616..594508
Genome map
AA seq 630 aa AA seqDB search
MAIEINVPDIGADEVEVTEILVSVGDKVEEEQSLITVEGDKASMEVPASQAGIVKEIKVV
AGDKVTTGSLIMVFEAEAAGAPGAAAAAPVPAVAPVAAPAAASELKEVCVPDIGGDEVEV
TEILVAVGDSIAEEQSLLTVEGDKASMEVPAPFAGTLKEIKVAAGDKVSTGSLVMVFEVA
GSGAAAPAPVAAAAPAAAPAAVSGVKEVNVPDIGGDEVEVTEIMVAVGDTVSEEQSLITV
EGDKASMEVPAPFAGTVKEIKVAAGDKVSTGSLIMVFEVAGAAPVAAAAPAQAAAPAPAV
APVAKAEAQATTSDFKENDEYAHASPVVRRLAREFGVNLSKVKGSGRKSRILKEDVQAYV
KDALKRLESGAVAAASGKGDGAALGLLPWPKVDFSKFGETEVQPLSRIKKISGANLHRNW
VMIPHVTQWDNADITELENFRKEQNAIEAKKDSGMKITPLVFIMKAAAKALEAFPAFNSS
LSDDGESLILKKYVNIGIAVDTPNGLVVPVFKDVNKKGIYELSEELMVVSKKARAGKLTA
ADMQGGCFTISSLGGIGGTAFTPIVNAPEVGILGVSKSEIKPVWNGKEFAPRLQLPLSLS
YDHRVIDGAEGARFITYLNECLSDIRRLVL
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgaaattaatgtacctgatatcggtgcggatgaggttgaagttactgagatt
cttgtaagcgttggcgacaaggttgaagaagagcagtctctcattactgtagaaggcgac
aaggcttctatggaagtacccgcctctcaagcgggtattgtaaaagaaatcaaagttgtt
gctggcgataaagtaacaacaggttctctcatcatggtctttgaagctgaagcggccggc
gctccgggtgcagcagcggctgcaccagttcctgctgtagcaccagtcgctgcacctgca
gcagcaagtgaactgaaagaagtttgtgtaccggatatcggtggcgacgaagttgaagtg
actgaaatcctagttgctgttggcgattcaatcgctgaagagcaatctctactgacagta
gaaggtgacaaagcttcaatggaagtaccagcaccattcgcaggtactctaaaagaaatc
aaagtggcagcaggcgataaagtgtctactggctcactcgtgatggtatttgaagtggcg
ggttcgggcgcagcagcacctgcaccagttgcagcagcagctccggcggcggctccagca
gcagtctctggagtaaaagaagttaacgttcctgatatcggcggcgacgaagttgaagtc
actgaaatcatggttgccgttggcgatacagtctctgaagagcaatctctgattactgta
gaaggcgacaaagcatctatggaagtacctgcacctttcgctggtacggttaaagaaatc
aaagttgcagctggtgacaaagtttctactggttctctaatcatggtgttcgaagttgct
ggcgcagcgccagttgcagcagcggcacccgctcaagcagcagctccagctcctgcggta
gctccagtagcaaaagcggaagctcaagcaacaactagtgatttcaaagaaaacgacgag
tatgctcacgcatctccagtggttcgtcgtctagctcgcgagttcggcgtaaatctttct
aaagtgaaaggttctggtcgtaagagccgtatcctgaaagaagacgttcaagcttacgtg
aaagatgcacttaagcgtcttgagtctggtgcagttgcagcggcttctggtaaaggcgat
ggcgcagcgcttggcctactaccatggccgaaagtggacttcagcaagttcggtgaaaca
gaagttcagccactatctcgcattaagaagatctcgggtgcaaacctacatcgtaactgg
gtaatgatccctcacgttacacagtgggataacgcggatatcactgagctagaaaacttc
cgtaaagagcaaaacgcgattgaagcgaagaaagactcgggcatgaagatcacgccactt
gtgttcatcatgaaagcggcagcgaaagcactagaagcattcccagcgttcaactcttcg
ctatcagacgacggtgaaagcttgattctgaagaaatacgtgaacatcggtattgcggtg
gatacgccaaatggcctagtggttcctgtctttaaagacgtgaacaagaaaggcatctac
gagctatctgaagaactgatggtggtttctaagaaagcacgtgctggtaagctgactgca
gcggacatgcaaggtggctgtttcacgatttcaagcctaggtggtatcggtggtactgcg
tttacaccaatcgtaaacgcgccagaagtgggtatccttggtgtgtctaagtctgaaatt
aagccagtttggaatggtaaagagttcgctcctcgcctacaactgcctctatctctatca
tatgatcaccgtgtgattgatggtgcagaaggtgcgcgcttcattacttacctaaacgag
tgcctatctgacattcgtcgtttggttctgtaa

DBGET integrated database retrieval system