KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02540Help
Entry
VVMO6_02540       CDS       T01415                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm00260  Glycine, serine and threonine metabolism
vvm00750  Vitamin B6 metabolism
vvm01100  Metabolic pathways
vvm01110  Biosynthesis of secondary metabolites
vvm01120  Microbial metabolism in diverse environments
vvm01230  Biosynthesis of amino acids
Module
vvm_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VVMO6_02540
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VVMO6_02540
Enzymes [BR:vvm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VVMO6_02540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV87562
Position
I:complement(2731403..2732683)
Genome map
AA seq 426 aa AA seqDB search
MKLYNIKENDEQVSFGQAVRQGLGRNQGLFFPAELPKFDDIDALLAQDFISRSTAILSAL
IGDELAEDKVNSMVDAAFQFPAPIKQVKEGVYALELFHGPTLAFKDFGGRFMAQSLAAVS
DGGKITILTATSGDTGAAVAHAFYGMEDINVVILYPKGKISPLQEKLFCTLGKNIHTVAI
NGDFDACQALVKQAFDDAELREEIGLNSANSINISRLMAQICYYFEAAAQMSKQERENLV
VSVPSGNFGNLTAGLLAKALGLPIKRFIAATNANDTVPRYLETGKWDPKPTVATTSNAMD
VSQPNNWPRIEELCRVKEWGLETLGKGAVSDEQSAQSVKDLYSLGYLCEPHGAIAYRVLD
QQLQEGETGLFLCTAHPAKFKEVVDDILGSDIDLPAPLAKHAVMELLSEELDADFTALKE
VLRRVQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttacaacataaaagaaaatgacgaacaagtttcctttggccaagccgtgcgc
caagggttaggccgtaatcaggggctatttttcccagcagaattaccgaaatttgacgat
atcgatgcattgcttgcgcaagattttatctcgcgcagcactgcgattctttctgcgtta
attggtgatgagctagcagaagacaaagttaactcaatggtggatgcggcattccagttc
ccagcaccgattaaacaagtgaaagagggtgtctacgctcttgaactgttccatggaccg
acacttgctttcaaagacttcggtggccgctttatggctcagtcgttggctgcggtttct
gatggtggaaaaatcactattctaacggcgacatcgggtgatacaggagccgcggttgca
cacgctttttacggaatggaagacatcaatgtggtcattctttatccgaaaggcaaaatc
agcccattgcaagaaaagctgttctgcacattaggcaaaaacattcacacggtagcgatc
aatggtgactttgacgcgtgtcaggcgctggtgaaacaagcgtttgatgatgcagaactg
cgtgaagagattggtctaaactctgcaaactcaatcaacattagccgtttgatggcgcaa
atctgctactactttgaagcagcggcgcaaatgagtaagcaagagcgcgagaatctggtg
gtgtcggtaccaagcggcaactttggtaaccttactgcgggtttgcttgctaaagctctg
ggtttaccgattaagcgctttatcgctgcaacgaatgccaatgataccgtgcctcgttac
ctagaaaccggtaaatgggatccaaaaccgactgtcgcgacgacctcaaatgccatggac
gtgagtcagcctaataactggccacgaattgaagagttgtgccgtgtgaaagagtggggt
ttggaaactttgggcaaaggtgctgtgtctgatgagcaaagtgcgcaatcggtgaaagat
ctctattcacttggttacctgtgtgaaccacatggtgcgattgcctatcgtgtgctggat
cagcagctacaagaaggtgaaactggcttgttcctctgtaccgcacatccggcgaagttt
aaggaagtggtcgatgacattcttggcagtgacatcgatttgccagcacctctagcaaaa
catgccgtgatggagctgctctctgaagagttggatgcggattttacggctctgaaagaa
gtattgcgtcgcgtgcaataa

DBGET integrated database retrieval system