KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02851Help
Entry
VVMO6_02851       CDS       T01415                                 

Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vvm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VVMO6_02851
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vvm02022]
    VVMO6_02851
Two-component system [BR:vvm02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   VVMO6_02851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV87873
Position
I:complement(3054797..3055516)
Genome map
AA seq 239 aa AA seqDB search
MQENFKILVVDDDARLRALLERYLSEQGFQVRSVANGEQMDRLLTRENFHLMVLDLMLPG
EDGLSICRRLRNANNMLPILMLTAKGDEVDRIVGLEVGADDYLPKPFNPRELLARIKAVL
RRQTIELPGAPSAEEKIVEFGEFRLNLGTREMFRGDEPMPLTSGEFAVLKSLVTNAREPM
SRDKLMNMARGREYSAMERSIDVQISRLRRMLEEDPSKPRYIQTVWGLGYVFVPDGKPA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaattttaaaattttagtggttgatgatgatgctcgcttgcgtgcgttgttg
gagcgttatctgtcagagcaaggtttccaagtgcgcagtgtcgccaatggggaacagatg
gatcgcctattgacccgtgaaaacttccacttaatggtgttggatttaatgcttcctggt
gaagatggtctttcgatctgtcgtcgtctgcgtaatgccaacaacatgttgcccatcctg
atgctaacggcaaaaggggatgaagttgaccgcatcgtgggtttagaagtgggtgctgat
gactacctgccaaaaccattcaacccgcgtgagctgttagcacgtattaaagcggtgctg
cgtcgtcaaaccatcgagctaccaggcgcgccaagcgcggaagagaaaattgtcgagttt
ggtgagtttcgtctgaacttgggcacgcgtgaaatgttccgtggtgatgagccgatgcca
ctcacctcgggtgaatttgcggtactgaaatcgctagtgaccaatgcgcgcgaaccgatg
tcgcgcgacaagttgatgaacatggcgcgcggacgtgaatactccgcgatggaacgttcc
attgacgtacaaatttctcgcctacgtcgtatgttggaagaggacccaagcaaacctcgc
tacatccaaactgtatggggcttaggttatgtgtttgttcctgatggcaaaccagcataa

DBGET integrated database retrieval system