KEGG   Vibrio vulnificus MO6-24/O: VVMO6_03903
Entry
VVMO6_03903       CDS       T01415                                 

Definition
(GenBank) uncharacterized protein ImpF
  KO
K11897  type VI secretion system protein ImpF
Organism
vvm  Vibrio vulnificus MO6-24/O
Brite
KEGG Orthology (KO) [BR:vvm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vvm02044]
    VVMO6_03903
Secretion system [BR:vvm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VVMO6_03903
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ADV88925
Position
II:complement(1069201..1069644)
AA seq 147 aa
MDKLTDSDPLSSIDRDFPLTRHALMDSLRRDLESLLNSRINWMTLSDELREIQTSILRYG
LPDFSSMPFSSADGQQVLCQRVKETIQQYEPRLNYVSVAIAEDKNPLDRILKLRIKATCM
IDNNEQELVMDSEVEPVSLGIKLSRAK
NT seq 444 nt   +upstreamnt  +downstreamnt
atggataaattgacggacagtgatcctctgagcagcattgatagagactttccattaacg
cgacatgcgttgatggattcactcagacgagatcttgaatcattactcaacagccgtatc
aactggatgacgttgtcagatgagctacgtgaaatacagacgtctatcttgcgatatggt
ttgccagatttctcatcaatgccatttagcagcgcggatgggcaacaggttctgtgccaa
cgagtgaaagaaaccattcaacagtatgaacctaggctcaactatgtgtcggtcgccatt
gcagaagacaaaaatccgctagatcgaattttaaaactcagaatcaaggcgacctgcatg
attgataataacgagcaggagttggttatggattcggaagttgagcccgtcagtctaggg
ataaaactgagtagagcgaaatga

DBGET integrated database retrieval system