KEGG   Vibrio vulnificus MO6-24/O: VVMO6_03913Help
Entry
VVMO6_03913       CDS       T01415                                 

Definition
(GenBank) uncharacterized protein ImpJ/VasE
  KO
K11893  type VI secretion system protein ImpJ
Organism
vvm  Vibrio vulnificus MO6-24/O
Brite
KEGG Orthology (KO) [BR:vvm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vvm02044]
    VVMO6_03913
Secretion system [BR:vvm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VVMO6_03913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: ADV88935
Position
II:complement(1081511..1082833)
Genome map
AA seq 440 aa AA seqDB search
MSVYSPIVWSEGMFLRPQHFQQQERALSHEYKGLTRLVGCYARGIESFSLDKEQLKEGVV
SLTECVGIFSDMTFVNIPIKEQLPEPLKIDPGIENTLVQLVIPAEKSQGQNVSHSETSMV
TRYKVVDHTLTDSVSGDEEVLQLAALKCELKATNDNLPGYVSLPLVKIRHVGSEGQVILD
EEFVPPFLNVHHSSLLTRYLNNVLAMIKIRADAIASRLGQGKSASSSAVDFIMLQMLNRY
EANLRHLSKGSELHPHELATALLSLIGELSTFSSKNKRVPKLPEYQHSNLGSVFSEMNQI
LSQYLSVVLEQTATKMPLDIRQFGIRVTPLPDKSLLSLCQFVLAVKADVSADEIRKKLPG
QIKVGPAENIRDLINNQINGIAVSPLNVVPRQMPYAAGYVYFELVKQGAYWARLNESGGM
AFHVSGNYPGLEMELWSINQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtttattcaccgattgtttggagtgaagggatgtttctgcgtcctcaacacttt
cagcaacaagagcgagcgttgtctcatgaatacaaaggtctaacgcgtttagtggggtgt
tatgcccgaggaattgaatcgttttctctcgacaaagaacagttgaaagaaggggttgta
tcgctaactgagtgtgttggaattttctccgatatgacattcgttaacatacctattaaa
gagcagcttcctgagccactcaaaattgatccagggattgaaaatactttggttcagctt
gtgatacctgcagaaaaatcccaaggccaaaacgtttcccattccgagacttcaatggta
acgcgctataaggtggttgatcacaccttaaccgatagcgtatctggtgatgaagaagta
cttcaactcgctgcgcttaagtgcgagttaaaggcaaccaatgacaatttgccgggctat
gtctctttgccactggtgaaaattcgtcatgttggtagcgaaggtcaagtcattcttgat
gaagagttcgtaccacctttccttaatgtccaccatagttcgctgcttactcgttatttg
aataacgttttagccatgatcaaaattagggcagacgccattgcaagtcgtctcggacaa
ggcaagtcagcgtcttcctctgcagtagatttcattatgctacaaatgctgaatcgttat
gaggctaacttaagacatttatcgaaagggagtgagcttcatccacatgagttagcgacg
gccttattgagcttaattggtgagctgtccactttctcgagtaaaaataagcgagtccct
aagcttcccgaataccaacacagtaatttggggtctgtcttttctgagatgaatcaaatc
ctcagtcaatatctgagtgtggtattggagcaaactgcgaccaagatgcccttggatatt
cgtcagtttgggattcgcgttacgccattaccagataaaagtttgctttcactttgtcag
tttgtattggccgttaaggccgatgtctctgccgatgaaattagaaaaaagttaccagga
caaatcaaagttggacccgcagagaatattcgcgaccttatcaataatcagatcaacggt
attgccgtttcgccactgaatgtggtgccaagacagatgccttacgcagcaggctacgtc
tattttgagctggttaaacaaggcgcttattgggctcgtttaaatgaaagcgggggaatg
gcatttcatgtctctggtaattacccagggttagaaatggagctttggagtattaaccaa
taa

DBGET integrated database retrieval system