KEGG   Vibrio vulnificus MO6-24/O: VVMO6_03959Help
Entry
VVMO6_03959       CDS       T01415                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase (isoleucine degradation)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm00071  Fatty acid degradation
vvm00072  Synthesis and degradation of ketone bodies
vvm00280  Valine, leucine and isoleucine degradation
vvm00310  Lysine degradation
vvm00362  Benzoate degradation
vvm00380  Tryptophan metabolism
vvm00620  Pyruvate metabolism
vvm00630  Glyoxylate and dicarboxylate metabolism
vvm00640  Propanoate metabolism
vvm00650  Butanoate metabolism
vvm00900  Terpenoid backbone biosynthesis
vvm01100  Metabolic pathways
vvm01110  Biosynthesis of secondary metabolites
vvm01120  Microbial metabolism in diverse environments
vvm01130  Biosynthesis of antibiotics
vvm01200  Carbon metabolism
vvm01212  Fatty acid metabolism
vvm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vvm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VVMO6_03959
   00630 Glyoxylate and dicarboxylate metabolism
    VVMO6_03959
   00640 Propanoate metabolism
    VVMO6_03959
   00650 Butanoate metabolism
    VVMO6_03959
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VVMO6_03959
   00072 Synthesis and degradation of ketone bodies
    VVMO6_03959
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VVMO6_03959
   00310 Lysine degradation
    VVMO6_03959
   00380 Tryptophan metabolism
    VVMO6_03959
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VVMO6_03959
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VVMO6_03959
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VVMO6_03959
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvm04147]
    VVMO6_03959
Enzymes [BR:vvm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VVMO6_03959
Exosome [BR:vvm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VVMO6_03959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV88981
Position
II:complement(1145275..1146492)
Genome map
AA seq 405 aa AA seqDB search
MAKSIWIVAAKRTPIGRFQGALAALSAPQLGAAAIHAAMDAVSLSAQQVDEVYMGCVLPA
GCGQAPARQAALKAELGYSTPCTTVNKVCGSGMKAVMLAYDQLKAGDKCCMIAGGMESMT
NAPYLLKESRSGMRMGHKTTFDHMFLDGLQDAYEGHLMGVYAQQIADKLNYTREQMDTWA
IQSAQRATQAQHEAQFKEEITPIFLEGRSSMTLDNDEHPTTIQLDKIPKLKPAFADDGTV
TAANSSSIADGAAALILADGDWAEKQGLTPLAIIRGHASHARLPAEFTVAPVYAIEQLLS
QLDWGIDEVDLWEINEAFAVVTQIAIQQLGLAADKVNIKGGACALGHPIGASGARILVTL
IHSLRQLQALGTNGDAKCRRSVKGVAALCIGGGEATAIGIEIPVF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatcaatttggatagtggcagcaaaacgtaccccgatagggcgattccaaggg
gcgctcgccgcgctgagtgcaccgcaattaggcgctgctgcgattcacgcggcgatggat
gccgtttcgttgtccgcgcaacaagtggatgaagtgtatatgggctgtgtgttgcccgca
gggtgtggtcaagcccccgcgcggcaagcggcactgaaagccgaattgggttattccacg
ccttgtaccacagtcaataaagtgtgtggttctgggatgaaagcggtgatgttggcctat
gatcagctcaaagcgggtgataagtgctgcatgattgcagggggaatggagagcatgacc
aatgccccatatctattgaaagagtcgcgcagcggcatgcgaatgggccacaaaaccact
ttcgatcatatgtttcttgatggattgcaagatgcctatgagggccatttgatgggcgtt
tatgcgcagcaaatcgctgacaaactcaattacacccgagagcaaatggacacttgggcc
attcaatcggcgcagcgtgcgactcaggcacagcacgaagcgcagttcaaagaggaaatt
accccgatttttctcgaaggacgcagcagcatgacgctggataatgatgagcatccaacc
accattcagctcgacaaaattcccaaactgaaacccgcgtttgccgatgacggtacggtg
accgccgccaattccagctcgattgcggatggcgcagcagcactgatattggccgatggt
gattgggccgaaaaacaaggcttaacaccgctggcgatcattcgcggccacgcaagccat
gctcgcttgcccgccgagtttaccgtcgcgcccgtttacgcgattgagcaattgctcagc
cagctcgattggggaatcgacgaggtggatttgtgggagatcaacgaagcgtttgccgtc
gtgacacaaattgctattcagcagctcggcttagccgcggataaagtgaacatcaaaggg
ggcgcctgtgcgttaggccaccctattggcgccagtggtgcccgaattttagtcactttg
attcacagcttgcgtcaactacaagcgttgggcaccaatggcgacgctaagtgccgtcgc
agtgtcaaaggtgtggctgcgctgtgcattggtggtggtgaagcgaccgccattggtatc
gaaattcccgtgttttga

DBGET integrated database retrieval system